KEGG   Shewanella baltica BA175: Sbal175_2431Help
Entry
Sbal175_2431      CDS       T02014                                 

Definition
Acetaldehyde dehydrogenase (acetylating) (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sbb  Shewanella baltica BA175
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sbal175_2431
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal175_2431
   00620 Pyruvate metabolism
    Sbal175_2431
   00650 Butanoate metabolism
    Sbal175_2431
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal175_2431
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sbal175_2431
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sbal175_2431
   00626 Naphthalene degradation
    Sbal175_2431
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sbal175_2431
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sbal175_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2878017..2880620
Genome map
AA seq 867 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYATFSQAQVDKIFRAAALAAADARISLAKMAAAETRMG
VVEDKVIKNHFASEYIYNKYKDEKTCGILSEDVTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHPKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFISHGGYMLSKDETAAMQQVILKNGGLNADIVGQS
AASIAQMAGFEVPHWTKVLIGEVTDICDSEAFAHEKLSPLLGMYRAIDFNDAMDKAEALV
ALGGIGHTSGLYTDQDTQTERVHAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPASIYFRRGSLPIALEELSDKKRA
LIITDRFLFNHGYCDETMRILKAQGLETEIFYDVEADPTLAIVRQGAKVAQSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGTKAMMVAIPTTSGTG
SEVTPFAVVTDEITGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYNLGSQSPVAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLINNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
KLGGKTDEEKVEKLLEKITHLKKTIGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLINELKQLFLDSYYGRDYSDNN
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgaccaatgcacaagaactggatctcatggtcgagcgtgtagcgaaagcacaa
gccgaatatgcgacattcagccaagcgcaagtcgataaaattttccgcgcagcggccctt
gccgctgccgatgcgcgtatctcgctggcgaaaatggccgccgcagaaactcgcatgggt
gtcgttgaagacaaagtgatcaaaaaccacttcgcctccgagtatatttataacaaatac
aaagatgaaaaaacctgcgggattttatctgaagacgtcaccttcggcactatcaccatt
gccgaacctgtgggtatcatttgtggcatagtaccgaccactaaccccacatcgaccgcg
atatttaaggccttaatcagccttaaaacccgtaacgcaattatcttctcgccccatcct
agggccaaagtttcaaccacaactgcggcaaagttagtgctcgatgctgccatagctgcg
ggtgcgcctaaagacattattggctggattgatgagcccagtgtcgcactgtcgaatcaa
ttgatgactcaccctaaagtcaatttgatcctcgcaacaggtggccctggcatggtgaaa
gccgcctactcttccggtaaacccgcgattggcgtaggtgcgggtaacacgcctattgtt
atcgatgaaaccgccgacatcaaacgcgcagtcagttcgattctcatgtcgaaaaccttc
gataacggcgtggtctgtgcctcagaacaagctgtgattgtggttgacagtatttatgag
caagtaaaagagcgctttatctctcacggtggctacatgctatcgaaggatgaaaccgcg
gcgatgcagcaggtcattttaaaaaatggcggtttgaatgccgatatcgttggccaaagc
gccgccagtatcgcgcaaatggcgggttttgaagtgccgcactggactaaggttctgatt
ggtgaagtcaccgacatttgcgacagcgaagccttcgcccatgaaaaattatcaccactg
cttggcatgtaccgtgccatcgactttaacgatgccatggataaagctgaagctttagtt
gcacttggcggtattggccacacttcagggctttataccgaccaagatacccaaactgaa
cgtgttcatgcctttggttttagaatgaaaacagcacgtatcttgatcaacacccctgcc
tcacagggcgggattggcgatctgtacaacttcaaactagcgccttcgctgacgttaggc
tgtggttcttggggcggcaactcgatttcagaaaacgttggcccgagtcatctgattaac
aaaaaaaccgtcgctaagagggccgaaaacatgttgtggcacaagcttcctgcatctatc
tatttccgccgcggcagtttacccatcgcacttgaagaactaagcgataaaaaacgcgcg
ctgatcatcaccgacagatttttgtttaaccacggttattgcgacgaaactatgcggatt
ttaaaggcccaaggccttgaaaccgaaatcttttacgatgttgaagccgaccccactcta
gccatagtccgtcaaggcgctaaggtggcccaaagctttaaacccgatgtgattattgcg
ctcggcggcggctcgccaatggatgcggctaagattatttgggtgatgtacgagcatccc
gatgtggattttgccgatttggcgctgcgttttatggacattcgtaaacgtatctacaaa
ttccctaaaatgggcaccaaagccatgatggtggctattccaactacctcaggcacgggc
tcagaagtcacgccttttgcggtagtgacagacgaaattaccggtaaaaaatacccgatt
gccgattatcaactcacgcccaacatggcgattgttgatcctaacctagtgatggacatg
cccaaatctctcaccgcctttggtggcatagatgcggtgacccatgctcttgaagcctat
gtcagcgtgatggcaaacgaatatagcgacggccaagcactgcaagccctcgacttactg
tgcaaatatttacccgatgcgtacaacttgggctcacagtcacctgtcgcccgtgaaaaa
gtccacaatggcgccaccatcgcaggtatcgcctttgctaacgctttcctcgggatttgc
cactcaatggcgcacaaactgggcgccgagttccatctcgcccacggcttagccaatgcg
ctactgatcaataacgtaatacgctttaacgcaacggatctgcccactaagcaagcggcc
tttagccaatacgacaggccaaaagccctgtgccgttatgctgccatcgcagatcacttg
aaactaggcggaaaaacggatgaagaaaaagtcgaaaaattgcttgagaaaatcacacat
ctcaagaagacgattggcattcctgcttctatccaagaagccggcgtcaacgaagccgac
ttcctcgccaagttagatgaattagccgaagatgcgttcgatgatcaatgtaccggtgcc
aatccacgttatcccttgattaacgagctgaaacaactgttcctcgatagctattatggc
cgcgactatagcgacaacaactag

DBGET integrated database retrieval system