KEGG   Shewanella baltica BA175: Sbal175_2615Help
Entry
Sbal175_2615      CDS       T02014                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00010  Glycolysis / Gluconeogenesis
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal175_2615
Enzymes [BR:sbb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sbal175_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AEG11866
UniProt: G0ARS5
Position
3095625..3096473
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDYFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSSEANFPQHGFARTRIWALESVEMRNQLVDLRFSLKISEQDKIYWPH
NTEVSVLFTLGDTLSISLVNTNLGDETVTLTQALHTYFPIEDIHQLKASGFSGSKYIEFA
EGPYPQTTDEVRFDRETDRVYTDLGPVQLLHTPQGIIEVSRENSQSAVLWNPWIEKSQRL
GRFNPEDYLTMVCLEAANVLEDKVVLAPGETHSLVTHICWKD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtcactactaaaaagcacgccaacgggctcgattatgtcgaggtcaacacg
gccttatgtcaggcaagaatttttttgcagggcgcgcaaatagactattttcaacccgta
ggcaaaccacctttactgtgggtttcatcggcggacgattatcaacccggtaatgggatc
cgtggcggtgtgcctgtatgctggccttggtttggcatgagtagtgaagcaaacttcccc
caacacggtttcgcccgcacccgcatttgggcgctggaatcggtagaaatgcgtaatcag
ttagttgatttacgttttagcttaaagattagtgaacaagataaaatttattggccgcat
aacactgaggtcagcgtgttattcaccctaggcgacaccttgagcatcagtcttgtgaat
accaacctaggcgatgaaaccgtgacgcttacccaagcgctgcacacttatttcccgatt
gaggatatccaccaactcaaggctagcggttttagtggctcaaaatacatcgaatttgcc
gaggggccttatccgcaaaccacggatgaagtgcgctttgatcgcgagacagatcgtgtc
tataccgatctcggccctgtgcaattattgcatacgccgcaggggatcattgaagtcagc
cgtgaaaacagccagtcagcggtattatggaatccatggattgaaaagtcacaacgcctt
ggccggtttaatccagaggattatttgaccatggtctgcctagaagcggccaatgtttta
gaagataaagtcgtgcttgccccaggtgaaacccacagtttagtgacgcatatttgctgg
aaagactaa

DBGET integrated database retrieval system