KEGG   Shewanella baltica BA175: Sbal175_2850Help
Entry
Sbal175_2850      CDS       T02014                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbb  Shewanella baltica BA175
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sbal175_2850
   00052 Galactose metabolism
    Sbal175_2850
   00500 Starch and sucrose metabolism
    Sbal175_2850
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal175_2850
Enzymes [BR:sbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sbal175_2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3359607..3360515
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttccagcgaccaaagccattccaaaggaaatgttaccggttgtcgataagccattgatc
caatacgtagtcagtgaagctatcgctgctgggatcaaagaaattgtcctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtacaatctatctgccctaaagacgtg
acggtgatcagcgtgcgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtcgtcggcgatgcaccatttgcagtattactgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccatctaacttagccgttgtaggccgttatgtgtta
cctgccagcatttggccactactggctaaaacccctgcaggcgcgggcgatgaaattcaa
ttaacggatgcaattgctatgttaatgaagcaagaaaccgtgaacgcttattatatggaa
ggtaagagccacgactgtggtaacaagcaaggttacatgcgtgcgaacgttgaatacgcc
ctgcgccacagcgaaatcggtgaagattttgcacaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system