KEGG   Shewanella baltica BA175: Sbal175_2877Help
Entry
Sbal175_2877      CDS       T02014                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00900  Terpenoid backbone biosynthesis
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal175_2877
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sbal175_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AEG12116
UniProt: G0AUF4
Position
complement(3396115..3397305)
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLSVISANPLAYSVYGLVANASVDKMLALCVAHRPKVAHMVDEA
AAKQLRAVLPATLNIQVTTGMNDLLGLVTAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVL
LANKEALVMSGELFIEATKRSGAVLLPVDSEHNAIFQCLPQEVQANLGRCDLATSGISHI
LLTGSGGPFLRSDIATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QAEQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFK
VGQLSFYEPDFERFPCLALAMDACAQGQEATTVLNAANEIAVEAFLQRQIGFTQIAKVNE
ACLVTVPKRPMGSIEDILALDAQTRVYARETLASIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattttgggtgctaccggctctataggtgccagtaccttaagtgtg
atctcggctaatccactcgcttatagcgtgtatggattagtggccaacgcgagcgttgat
aagatgcttgcactctgtgtggcccatagaccgaaagtggcgcatatggtggatgaagcg
gcagcaaaacagttgcgtgccgttttacctgcgacgctcaatatccaagtcaccacaggc
atgaacgatttactcggtttagtgacagctgccgaagtggatactgtgatggcggcgatt
gttggggctgcagggctagtaccgacgcttgaagccgtaaaggcggggaagcgggtatta
ctggccaacaaagaagccttagtcatgtcaggtgagctgtttattgaggcgactaagcgc
tctggcgcagtgctcttgcctgtggacagtgagcataatgccatcttccaatgtctcccc
caggaagtgcaagccaaccttggccgttgtgacttagctacgtcgggtatttcccatatt
ctgttaaccggttctggcggacctttcctgcggtcggatattgcgacactggccgccatg
acgcctgcccaagcctgtaaacatcctaattggtccatgggacctaaaatctccgtcgac
tccgccactatgatgaataagggcttagagtttattgaggcacggtggttgtttaacact
caggctgagcaactgaaggtggttatccatccgcaaagcgtgatccactctatggtgcag
taccgtgatggctcagttattgcccaaatgggtaacccagatatgcgtacgcctattgcc
cattgcatggcttatccgcaaagaattcattctggcgttgaacctttagattttttcaaa
gtcggacagttaagcttttatgaacctgattttgaacgtttcccctgtttggctctggca
atggacgcgtgtgcccaaggccaagaggcgacaactgtgttaaatgcagccaatgagatt
gctgttgaagcgtttttacagcgacaaattggctttactcaaattgcaaaagtgaacgaa
gcttgtttagtgactgtgcctaagcgtcctatgggcagcatagaagatattttagcctta
gatgcgcaaacccgcgtctatgcgcgtgagaccttagcaagcatcgcttag

DBGET integrated database retrieval system