KEGG   Shewanella baltica BA175: Sbal175_3019Help
Entry
Sbal175_3019      CDS       T02014                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00630  Glyoxylate and dicarboxylate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01200  Carbon metabolism
Module
sbb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal175_3019
Enzymes [BR:sbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sbal175_3019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEG12258
UniProt: G0AW42
Position
complement(3580235..3581560)
Genome map
AA seq 441 aa AA seqDB search
MTKATTQTSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARVFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagacttcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactatcgctaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctacgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgccgatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgtcgtgctgaccaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattacttcctgcca
atcattgctgacgcagaagcgggttttggcggcgtattaaatgccttcgaactgatgaag
tcgatgatcgacgcgggcgctgccggcgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggatgtgagcggtgtcgatacactggttattgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgatttcgtg
actggcgagcgtactaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcgtgtttttgctgaagcgattcatgctcagtacccagatcaactg
ttagcgtataactgttcgccttcgttcaactggaagaaaaatctggacgacgccaccatt
gcgcgcttccaacaagcattgtcagacatgggctacaagtaccagttcatcactttagcc
ggcatccacaacatgtggtacaacatgttcgacctcgcttatgactatgctcgtggcgaa
ggtatgaagcattatgttgagaaagttcaagaagttgagtttgctgcagcgaagaaaggt
tacaccttcgtcgcgcatcaacaggaagtgggcacaggttatttcgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttctaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system