KEGG   Shewanella baltica BA175: Sbal175_3020Help
Entry
Sbal175_3020      CDS       T02014                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbb  Shewanella baltica BA175
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sbb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sbb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sbb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3581701..3583350)
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAIPGSMFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKHHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacccttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgagtttgccgacgaagtacctgcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctattcgtgatggtgcatggcaaattcggggtattcccgatgacttg
cttgaccgccgcgtagaaatcacaggtcccgttgaacgtaagatggtgattaacgcactc
aatgccaatgccaaagtgtttatggccgatttcgaagattctttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggacacaggtaagcactacaaattaggaccaaatccggcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaacggcaaagcgattccaggc
tcaatgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggc
agtggtccatacttttatattcctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctacgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcaccatagcgaccgtgttttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagcg
atgggcggcatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
caacgagtccgtcgagataaagaactggaggcgcgtaacggccacgatggcacttgggtg
gcacaccctggtcttgccgataccgctatgggtattttcaacgaatacataggccaagat
cactgtaatcaattgcatattacccgtgatgtcgatgcgcctattctggctagcgaactg
cttaaaacctgcgacggtgagcgcaccgaacaggggatgcgtctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcggctacggctgagatttctagagcctcaatttggcaatggatccaacatggt
aagtcgctgtcaaacggtaaactcgtgaccaagcaactctttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggcggtattgctcgaagacattaccacctccgacgagctggttgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system