KEGG   Shewanella baltica BA175: Sbal175_3188Help
Entry
Sbal175_3188      CDS       T02014                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00511  Other glycan degradation
sbb00520  Amino sugar and nucleotide sugar metabolism
sbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal175_3188
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sbal175_3188
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal175_3188
Chaperones and folding catalysts [BR:sbb03110]
 Intramolecular chaperones
  Others
   Sbal175_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b Prominin
Motif
Other DBs
NCBI-ProteinID: AEG12424
UniProt: G0AXQ4
Position
complement(3780636..3783434)
Genome map
AA seq 932 aa AA seqDB search
MNKTLSASAILLALGLAACSEAPVTPSAASADKAVAQTQQAQDALTQAQLQQLGDSLVVT
YRVVTNVPDDKCLKDKADGRCFVAQIDFVPGMDLASQDWEIYLSQMRPVQSVESGELTIT
HVKGDLHRITPTAAFKGFVKGEKKQLTFRGEPWQLAETDAMPNYYLAAKGLEPVIIASTQ
VGKDVETGLETRPYVEGFTNFKTQYQRTETDKLAPADAAQLFKDNQSVSEDAALAVDTII
PKPQKVKINSTDTPVSLAGGIKLEYQQDNPEQKSQVAAAVARLARLGVAESASGMTVKFA
SQKGDEGSYRLDIQPTEIVIASNDAAGFSYGLSSLASLVDVNSLKVNAMTIEDSPRYPFR
GMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTDIGSKRCH
DLDENTCLLPQLGSGPFGDTSVNGYYTKQDYIDIVKYAEARQIQVIPSMDMPGHSRAAIK
AMDARFRRLQSEDVELKNTGKVQVVPVQETVNQASTAVKALDAGARQLQAEGKTTAAEQY
LLSDENDKTVYSSVQYYDDNTLNVCMESTYHFVDKVIDEIAKLHQAAGQPLTRYHIGADE
TAGAWKQSPQCLAFVANNDKGVKSIDDLGAYFIERISTMLAAKGIEAAGWSDGMSHVRPE
NMPAKVQSNIWDVIAHKGYERANQQANLDWETVLSNPEVLYFDFPYEADPKEHGYYWASR
ATNSHKVFSFMPDNLAANAEQWTDIQNQPFEADDRIKLDEAGNKVSGPREKGKPFTGLQG
QVWSESIRSDDTIEYMVFPRLLMLAERAWHQAAWEVPYQYQGAVYSQSSGAFTLAMRDAQ
AKDWQQLANTLGHKEFVKLDKAGIDYRVPTVGAEIRDGKLFANIAYPGLKLEYRSLNGQW
QAYQAGQAVTAPIEVRAIAADGIRKGRSLIVN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacactttcagcaagcgccattttactggctttaggattagcggcctgttcc
gaggcgcctgtgacgccttccgcagcgtcagccgataaggctgtggctcaaacacagcaa
gctcaggacgcattaactcaagcgcagttacaacaactcggggattcgttagtcgtaact
taccgtgtcgtgaccaatgtgccagatgataagtgcctaaaagataaagccgatggtcgc
tgttttgtcgctcaaattgatttcgtgcccggtatggatttagccagccaggattgggaa
atttatttaagccaaatgcgcccagtgcaatcggttgaaagcggtgaattgacgataacg
cacgttaaaggtgatttacatcgtattacgccaacggctgcttttaagggatttgttaag
ggcgagaaaaagcaactaacgttccgtggtgagccgtggcaattggctgaaaccgacgct
atgccaaactattacctcgcagcaaaaggattagaacccgtcattatcgccagcactcag
gtagggaaagatgtcgaaacgggtttagagacgcgtccgtatgttgaagggtttacgaat
tttaaaacccaatatcaacgcactgaaacggataaactcgcgccagccgatgccgcgcaa
ttatttaaagacaatcaaagcgtgagtgaagatgccgccttggctgtggataccattatc
ccaaagccacaaaaggtgaagataaattcaactgatacaccagtatcgcttgctggtggt
attaagctcgaatatcagcaagataacccagagcaaaagagtcaagttgcggcggcggtg
gcacgtttagctcgcctgggggtggctgaatctgcgagtggcatgacggtgaaatttgcc
agccaaaaaggggatgagggcagttatcgcttagatattcagccaactgaaattgtgatc
gcttccaatgatgcggcgggcttctcttacggtttgtcatcattagcaagccttgtggat
gtgaattcgctgaaagtgaatgccatgaccattgaagacagcccacgttatccgttccgt
ggtatgcacattgatgtggcacgtaatttccacagcaaacaattgttgctggatttgctc
gaccaaatggcggcttataagctcaataaactgcatttacacatggctgacgatgaaggt
tggcgtttagaaatcgacgggctacctgagctgactgacatcggtagtaaacgttgtcat
gatttagatgaaaatacctgcttattaccgcagttaggcagtggaccgtttggcgatact
agtgttaatggctattacaccaaacaagactatatcgacatagtgaaatatgccgaggcg
cgtcaaattcaagtgatcccatcgatggacatgccgggtcatagccgcgccgcaattaaa
gcgatggatgcgcgttttcgtcgattacagtctgaagacgtagagcttaaaaacacgggc
aaagtgcaggttgttcctgtgcaggaaacggtaaatcaagctagcacagcggtaaaagcg
ttagatgcgggcgctcgtcaattgcaagctgaagggaaaaccactgcagctgagcaatat
ttgttatccgatgaaaacgacaaaacggtttattcttcagtgcagtattacgacgacaac
acgcttaacgtgtgtatggagtcgacttatcactttgtcgataaagtgattgatgaaatt
gccaagttacaccaagccgcgggtcaaccattgacgcgttaccacattggtgccgatgaa
acagcgggagcttggaaacaatcaccccagtgtttagcatttgtcgccaataacgataaa
ggcgttaagtcgatagatgacttaggcgcttattttatcgagcgaatttcgactatgtta
gcggccaaaggtattgaagctgcggggtggagcgatggcatgagccatgttcgccctgag
aatatgcccgctaaagtgcagtctaatatttgggatgtgattgcccataaaggctatgag
cgcgccaatcagcaggcgaatcttgattgggaaaccgtgctctctaatcctgaggtgttg
tactttgatttcccctatgaggccgatcccaaggagcatggttattactgggcgagccgc
gcgaccaacagccataaagtctttagctttatgccagataacttggccgccaatgccgag
caatggaccgatattcaaaatcagccgttcgaagcggacgacagaataaaacttgatgag
gcgggtaacaaagtctcgggcccaagggagaaaggcaaaccttttactggcttgcaaggg
caggtctggagtgagtcgattcgcagtgacgatacgatcgaatacatggtgttcccgcgt
ttgttgatgttggctgagcgtgcttggcatcaagccgcatgggaagtgccttatcaatat
caaggcgctgtatatagccaaagttcgggcgcttttactttagccatgcgtgatgcacag
gcaaaggattggcaacaacttgcgaataccttaggtcataaagagtttgttaagttagat
aaagcggggattgattatcgcgtaccgacggtcggcgccgagatccgtgacggtaaactg
tttgccaatatcgcctatcccggactcaaactggaataccgaagcctaaatggccaatgg
caagcttatcaagcgggacaggcggtcactgcaccgattgaggtccgtgccatagctgcc
gatggtattcgtaaaggccgaagtttaatcgttaactaa

DBGET integrated database retrieval system