KEGG   Shewanella baltica BA175: Sbal175_3429Help
Entry
Sbal175_3429      CDS       T02014                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbb  Shewanella baltica BA175
Brite
Enzymes [BR:sbb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sbal175_3429
Secretion system [BR:sbb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal175_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4068735..4069460)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacccgagcattatctttaatttttgcccttgttgtagctcctcttgctcac
gccgcaacagcgacctcgccagataccgctgctattaagcaaaaactgactgagatgttg
gatgttgaagtcatttctatgcaggattcgccgattgagggtttgtatcaagccatgacc
aaccgcggcgtgctctatattagtcgtgatggttcaaaactgttccacggcagtttgtat
gacctagataaaggcatgaaaaacttaacggaagcggcattagctggtccacgtttagaa
atgatgaagccgcttgaagaccatatgttggtttacaaagccaaaaatgaaaaacacgtg
gtcactgtatttaccgacgtcagctgtggttattgccgtaaattgcacagccaaatggcc
gattacaacaagcttggcattaccgtacgttacttagccttcccgcgtgcgggcgtgccg
tcagccaacgccgacgaaatgcaagccatctggtgtgctaaagatccattaaaagccatg
acagacgctaaagcgggcagcaaagttgccgcagcaacatgcgatgctaaaattgccgag
caatatgctttaggcaccacctttggtgtgaatggtacgccggcaatcgtgttagaagat
ggcaatatgatcccaggttatcaaccccctgcggacttattacgcaccttagaagcgcgt
cagtaa

DBGET integrated database retrieval system