KEGG   Shewanella baltica BA175: Sbal175_3532Help
Entry
Sbal175_3532      CDS       T02014                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00900  Terpenoid backbone biosynthesis
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal175_3532
Enzymes [BR:sbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sbal175_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEG12763
UniProt: G0B0U5
Position
4181779..4182633
Genome map
AA seq 284 aa AA seqDB search
MPAAISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDCCDMLDFKVTETPELILHSN
MSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNKL
WHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQAVNPSEPWYLVIAPDAHVST
ADVFQDPLLPRDTPKLAIDTLMSQPWANDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSPLITRLSHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcaatttcccgcaattggcctgcgccagccaagctcaacttgtttttgcac
ataaatggtcgccgcgccgacggttaccacgaactgcaaaccttgtttcagtttatcgat
tgctgcgacatgctcgattttaaggtcactgaaacccctgaactgattttgcactccaat
atgtcgggcgttgtcgctgacagcgataacttaattctgcgagccgcaaaatcattacag
caaaccacgggctttaacggtggcgcagagatctggctggataaacgcctgcccatgggc
ggcggtttaggcggcggctcgtccgatgctgcgaccacattagtggcattgaacaagtta
tggcatacccaattatcgaccgaagaattggctaaaatcggccttaaattgggtgccgat
attcctgtttttattcatggtttcgccgcttttgccgaaggtgtgggtgaacgcttgcaa
gcagtaaatccgagtgagccttggtacttagtcatagcacccgatgcccatgtttccacc
gccgacgtattccaagatccacttttaccgcgtgataccccgaaactggccatagatacc
ttaatgagccaaccttgggcaaatgattgtcaaaaactagtcgtttctaaataccctcaa
gttgccaaggcattaggctggctgctagaatatgcgccgtcgagaatgacaggaacaggc
gcatgcgtgttcggggaattcacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgaaatgcaaggatttgttgcacaagggatgaatctttcgccgctcatcacgcga
ctcagtcacccttaa

DBGET integrated database retrieval system