KEGG   Shewanella baltica BA175: Sbal175_3849Help
Entry
Sbal175_3849      CDS       T02014                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbb  Shewanella baltica BA175
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sbal175_3849
Enzymes [BR:sbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sbal175_3849
Exosome [BR:sbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal175_3849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4555430..4556914)
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
IEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSSEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTMLFNIHSLTWDNKLLEALDIPLSLLPEVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMTKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAETRVR
LYAGWQDAVARTRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggccttagatcaaggcacgaccagctcaagggcgatagtg
ttcgatcacgatgcaaacattgtcagcgtgtcccagcgggaatttacccagttgtaccct
aatccgggttgggtcgagcatgatcccatggagatctgggcaagccaaagttcagtatta
attgaagtgctggcgcgcgcggggatccacagcgatgaagtggccgcgattggcattacc
aatcagcgggaaactacagtcatttgggagaaagctacaggtaaacctatctataacgcg
attgtgtggcagtgccgtcgtagctctgaaatttgtgagcaactcaaagctcaagggcta
gaagagtatgtccgtgaaaacacaggcctgttactcgacccttatttttcaggcactaag
atcaagtggattctagataatgtgcccaatgcccgtgcgcaagccgagcgaggtgagttg
ttgttcggcactattgatacttggctagtgtggaagttaaccgagggcaaagtgcatgtc
accgatcccaccaatgccgcccgtactatgctgtttaatatccatagcctgacttgggat
aacaagttacttgaagctttagacattcccttgtctttgttgcccgaagtgaagccttcc
tgcagtgtttatggcaccacgcggattgccggtgaaggcagtgaaattcaagtcgcaggg
atggcgggtgaccaacaagcggcgctttttggtcagctgtgtgtcgagcccggcatggcg
aagaatacctatggcactggctgttttttattgatgaataccgggaccaaagcggtgcgt
tctaaccatgggttactgaccacagttgccgtgggaccgaagggcgaagtgaactatgcc
ctcgaaggttcagtcttcatgggtggcgcgaccattcaatggctgcgggatgaactgggg
cttattcgtgacgccagtgatactgagtattttgcctctaaggttgctgataccaatggc
gtgtatttagtgcccgcttttgttggactcggggcgccctattgggatcccaatgcccgt
ggcgcactctttggtttaacccgtggcgccaaccgtaatcatattattcgtgcggcgtta
gaatccattgcttatcagagtaaagatttactcgatgccatgaccaaagacagtggcgtt
agccttaagcgtttgaaggtggatggcggcgcggtcgccaatgattttttgatgcagttt
caagccgatatcaccgatgtcgaagtattaaggccgagtgtttgtgagacaaccgctttg
ggcgcggcatttttagctggcttggcggtgggcttttgggagagtgtcatagagcttgaa
cataaagcttgtatcgataagcatttcatccccaatattgacgccgagactcgggtgcgg
ttatacgcaggttggcaggatgccgtcgccagaactcgcgcctaa

DBGET integrated database retrieval system