KEGG   Shewanella baltica BA175: Sbal175_3868Help
Entry
Sbal175_3868      CDS       T02014                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00790  Folate biosynthesis
sbb01100  Metabolic pathways
Module
sbb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal175_3868
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sbal175_3868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEG13091
UniProt: G0AS27
Position
4578212..4578862
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacgttaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtacgtcgatgaaatcttctccggcttagattatgcgaac
ttccctaagatcacggttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagcacctgcgaacaccatttagtgacgatcgatggtactgcgacc
atagcttatctaccacgcaaaaaaatcattggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaagtgcaagagcgtttgactcagcaagtgttagtcgcgctg
cagaccttgctcgaaactaaagatgttgcggttaaaatggatgcagtgcattactgcgta
aaatcccgtggagtgatggactcaaccagttcgaccactaccacagcgctgggcggtatt
ttcaaatctaaccctgcgacccgcgccgagtttttgcaccagtctaaataa

DBGET integrated database retrieval system