KEGG   Shewanella baltica BA175: Sbal175_4223Help
Entry
Sbal175_4223      CDS       T02014                                 

Definition
Malate synthase family protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbb  Shewanella baltica BA175
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal175_4223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal175_4223
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal175_4223
Enzymes [BR:sbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal175_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4964435..4964998
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLRDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHVGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcgcaagtgaatgtcgccgagcacgagaagatcgccaatgcg
aaacaattcctcgaccgcctctttccactcaactctggttcacaccaagatgtgagcagc
tatgtggtttactatcaacacctgttggctttttttgccgacggcagccatagcggttta
cgtcagccaaaacagttcgtggcctttaatggcactaaagatgcgccttgcgccatagtg
ttgcgggaccttggttgccatgttgaactcagtttcgatcgcaacggcatgataggggca
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatcgtcgga
acaccagagtcacgttcagctgcatcgcgtcattggctcagtctgttacatgtgggtatg
tccagcgccaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system