KEGG   Shewanella baltica BA175: Sbal175_4223Help
Entry
Sbal175_4223      CDS       T02014                                 

Definition
(RefSeq) Malate synthase family protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbb  Shewanella baltica BA175
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal175_4223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal175_4223
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal175_4223
Enzymes [BR:sbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal175_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4964435..4964998
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLRDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHVGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcgcaagtgaatgtcgccgagcacgagaagatcgccaatgcg
aaacaattcctcgaccgcctctttccactcaactctggttcacaccaagatgtgagcagc
tatgtggtttactatcaacacctgttggctttttttgccgacggcagccatagcggttta
cgtcagccaaaacagttcgtggcctttaatggcactaaagatgcgccttgcgccatagtg
ttgcgggaccttggttgccatgttgaactcagtttcgatcgcaacggcatgataggggca
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatcgtcgga
acaccagagtcacgttcagctgcatcgcgtcattggctcagtctgttacatgtgggtatg
tccagcgccaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system