KEGG   Shewanella baltica BA175: Sbal175_4252Help
Entry
Sbal175_4252      CDS       T02014                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sbb  Shewanella baltica BA175
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sbb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4995123..4995938
Genome map
AA seq 271 aa AA seqDB search
MPELPEVEVTRQGIAPFLVEQTVVDLVIRNGSLRWPVPDIAKQIIGQDIRQVRRRAKYLL
IDTDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAWLWCELP
EEAHPLLAKLGPEPLTQAFNVAQLAAALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAA
GIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNADGKPGYFAQKLHVYGR
GGETCTSCGNLLSEIRLGQRTTVFCGICQTR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattaccagaagttgaagtcacccgtcagggtattgcacccttccttgtcgag
caaaccgtggttgatcttgtgatccgcaatggttcgctgcgctggccagtgcctgacatc
gccaaacaaattatcggccaagacatacgccaagtgcgacgccgtgctaaatatctttta
atcgacactgatgcgggcacgagcatagtgcatttaggcatgtcggggagtttacggatt
ttgccccacgataccccagtggaaaagcatgaccatatcgacttagtgctcgccaatggc
cgcattttacgttttaacgatccgagacgattcggtgcttggctatggtgtgaactccca
gaagaagcgcatccattactcgccaaactggggccagagccactgactcaagcctttaat
gtcgcacaattagcggcagctttagcgggcaagaaaaaggccatcaaactctgcctgatg
gataatcatatcgtggtgggtgtgggtaatatttacgccaatgaagccctgtttgcggcg
ggcattcatccagaagccgaagcaggtaaaatcgatatcgagcgcttgaccgttttagtt
gccgaagtgaagcaaatcttagcccacgccattaagcaaggcggcactacgttgaaagac
tttaccaatgccgatggcaagccgggctacttcgcccaaaaactgcatgtctacggtcgc
ggcggtgaaacctgcaccagctgcggtaacttattaagtgaaatccgtttaggtcaacgc
accacagtattctgtggcatttgccagacacgctaa

DBGET integrated database retrieval system