KEGG   Shewanella baltica BA175: Sbal175_4283Help
Entry
Sbal175_4283      CDS       T02014                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sbb  Shewanella baltica BA175
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal175_4283
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal175_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5029313..5030296
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRDLYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRYAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaagcgttgttcaagacacgctgatcacagctgatggcatcacgctggct
tatatgatggtcaaacatccccaagcgcataccgcaatcgttctcagtagtggccgagtt
gaatcctatttaaagtatcaagaattggtcttcgacttgtaccaacagggttactcagtt
tatgccatagatcaccgtggccaaggattgtcggatcgtatgacaatcaatccgcacatg
ggccacgtgcgaagattcaatgattatatcgatgattttgcactgtttatgcaaaagaaa
gtgttaccgcaaaacgacaaacaactcatgctacttggccattcaatgggcggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgccc
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagccagtaaactc
gataccactctcaatggcggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgccaaagtagataccaagcctatcgagac
ttgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagacacctgcgtactggcaacagcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcagcccagaatcttgcggtgagc
actcattgccaattgaaggtgatagcgggggctgcccatgagatttttatggaaaaagac
gcctatcgaaaccaagccttaaattatgccctcgacttctttaaacgctacgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system