KEGG   Shigella boydii CDC 3083-94: SbBS512_E0284Help
Entry
SbBS512_E0284     CDS       T00700                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00860  Porphyrin and chlorophyll metabolism
sbc01100  Metabolic pathways
sbc01110  Biosynthesis of secondary metabolites
sbc01120  Microbial metabolism in diverse environments
Module
sbc_M00121  Heme biosynthesis, glutamate => heme
sbc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SbBS512_E0284 (hemB)
Enzymes [BR:sbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SbBS512_E0284 (hemB)
Exosome [BR:sbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SbBS512_E0284 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: ACD09382
UniProt: B2U3X1
Position
complement(280430..281404)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggcgtgatgcgcattccagagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgacgcctggcgggaagatggactggtggcg
cgtatgtcgcgcatctgcaagcagactgtgccagaaatgatcgtcatgtcagacacttgt
ttctgtgaatacacttctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggcgcagac
ttcatcgccccttccgccgcgatggacggccaggtacaggcgattcgtcaggcgctggac
gctgcaggctttaaagatacggcgattatgtcgtattcgaccaagttcgcctcttccttt
tatggcccgttccgtgaagctgccggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgcgaggcgattcgtgagtcactgctggatgaagcccagggc
gcagactgcctgatggttaaacctgctggagcgtacctcgacatcgtgcgtgagctgcgt
gaacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtacgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttca
attaagcgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system