KEGG   Shigella boydii CDC 3083-94: SbBS512_E0577Help
Entry
SbBS512_E0577     CDS       T00700                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SbBS512_E0577 (asnB)
Enzymes [BR:sbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SbBS512_E0577 (asnB)
Peptidases [BR:sbc01002]
 Cysteine Peptidases
  Family C44
   SbBS512_E0577 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554683..556347
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVTSEMKSLVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSNQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgctcacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaacccacgtactggcggtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttatcagttccagacagggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtgacctca
gaaatgaaatcgctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagccaggacggcgaaatccgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggctctggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgcagcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttacactcctttgctgtaggtctgccgggttcaccggat
cttaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctttac
ttccataaagcgcccaacgctaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctaatcagcaactggaaact
gcccgcttccgcttcccgtacaacacgccaacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgcctggcggtccttcc
gtcgcgtgttcttccgctaaagcgatcgaatgggatgaagcgttcaagaaaatggacgat
ccatctggtcgtgcggttggtgttcaccagtcggcatataagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system