KEGG   Shigella boydii CDC 3083-94: SbBS512_E0641Help
Entry
SbBS512_E0641     CDS       T00700                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00020  Citrate cycle (TCA cycle)
sbc00190  Oxidative phosphorylation
sbc00650  Butanoate metabolism
sbc01100  Metabolic pathways
sbc01110  Biosynthesis of secondary metabolites
sbc01120  Microbial metabolism in diverse environments
sbc01130  Biosynthesis of antibiotics
sbc01200  Carbon metabolism
Module
sbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SbBS512_E0641 (sdhD)
   00650 Butanoate metabolism
    SbBS512_E0641 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SbBS512_E0641 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACD10031
UniProt: B2TUA6
Position
610963..611310
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYAKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgctaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system