KEGG   Shigella boydii CDC 3083-94: SbBS512_E1195Help
Entry
SbBS512_E1195     CDS       T00700                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00521  Streptomycin biosynthesis
sbc00523  Polyketide sugar unit biosynthesis
sbc01130  Biosynthesis of antibiotics
Module
sbc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SbBS512_E1195 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SbBS512_E1195 (rfbC)
Enzymes [BR:sbc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SbBS512_E1195 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACD08089
UniProt: B2TYE4
Position
1101346..1101903
Genome map
AA seq 185 aa AA seqDB search
MKVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAIGRKVEFVQDNHSKSNKGVLRG
LHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSSENMRQLWIPEGFAHG
FLVLSDTAEFLYKTTKYYHPESDSGIIWNDKNIGICWPLREKPIISEKDSNLLPFAHLTR
KQINL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattaaaactgaaattcctgatgtattaattttcgaaccgaaagtttttggc
gatgagcgtggtttctttatggaaagctttaatcagaaagttttcgaagaagctataggg
cgtaaggttgaatttgttcaggataaccattcgaagtctaataaaggcgttttacgcggg
ctgcattatcagttagaaccttatgcgcaaggaaaattagttcgctgtgttgttggcgag
gtttttgatgttgctgtggatattcgtaagtcatcccctacgtttggtaaatgggttggt
gtgaatttatcttctgagaatatgcgacagttatggatacctgaaggatttgctcatggg
tttttggtgctgagtgatactgcggaatttttatataaaacgacgaagtattaccatcca
gagagtgacagtggtattatttggaatgataaaaatatcggaatttgttggccattaaga
gaaaaaccaataatatcagaaaaagatagcaatctattaccctttgctcatttaactcgc
aaacaaataaatttatga

DBGET integrated database retrieval system