KEGG   Shigella boydii CDC 3083-94: SbBS512_E1450Help
Entry
SbBS512_E1450     CDS       T00700                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbc  Shigella boydii CDC 3083-94
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1323265..1323798
Genome map
AA seq 177 aa AA seqDB search
MSAKIKYGLSAAVLALIAAGASAPQILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASLCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaatcaaatacggcctgtcagctgctgttctggcgctgattgctgcaggc
gcgtctgctcctcaaatacttgaccagtttctggatgaaaaagagggtaaccacactacg
gcataccgcgatggttccggtatatggaccatctgtcgtggtgccacaatggtggatggt
aagcccgtcataccgggaatgaagctgtcgaaggaaaaatgcgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
cagaaagcgggtatagcgtcattatgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatggtgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcagtga

DBGET integrated database retrieval system