KEGG   Shigella boydii CDC 3083-94: SbBS512_E1682Help
Entry
SbBS512_E1682     CDS       T00700                                 

Gene name
glsA
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00220  Arginine biosynthesis
sbc00250  Alanine, aspartate and glutamate metabolism
sbc00471  D-Glutamine and D-glutamate metabolism
sbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SbBS512_E1682 (glsA)
   00220 Arginine biosynthesis
    SbBS512_E1682 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SbBS512_E1682 (glsA)
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SbBS512_E1682 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: ACD07565
UniProt: B2U171
Position
1531621..1532547
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacagtagacggttcccga
ttgggcattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgctggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcaccacggcaacgtatgctggaa
gtcgtgcgcggcttaagcggtgtgtctgatatttcatacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggctaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agtggtatgtaccagaacgcgggggagtttgcctggcgggtggggctaccggcgaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgctgtctggagt
ccggaactggatgatgcaggtaactcgcttgcgggtatcgccgtccttgaacaattgacg
aaacagttagggcgttcggtttattaa

DBGET integrated database retrieval system