KEGG   Shigella boydii CDC 3083-94: SbBS512_E1873Help
Entry
SbBS512_E1873     CDS       T00700                                 

Definition
aldehyde ferredoxin oxidoreductase
Organism
sbc  Shigella boydii CDC 3083-94
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1715346..1716992)
Genome map
AA seq 548 aa AA seqDB search
MTSPETCVAAIGQAGENLVPLSGMLNSRNHSGGAGTGAIMGSKNLKAIAVEGTKGVNIAD
RQEMKRLNDYMMTELIGANNNHVVPSTPQSWAEYSDPKSRWTARKGLFWGAAEGGPIETG
EIPPGNQNTVGFRTYKSVFDLGPAAEKYTVKMSGCHSCPIRCMTQMNIPRVKEFGVPSTG
GNTCVANFVHTTIFPNGPKDFEDKDDGRVIGNLVGLNLFDDYGLWCNYGQLHRDFTYCYS
KGVFKRVLPAEEYAEIHWDQLEAGDVNFIKDFYYRLAHRVGELSHLADGSYAIAERWNLG
EEYWGYAKNKLWSPFGYPVHHANEASAQVGSIVNCMFNRDCMTHTHINFIGSGLPLKLQR
EVAKELFGSEDAYDETKNYTPINDAKIKYAKWSLLRVCLHNAVTLCNWVWPMTVSPLKSR
NYRGDLALEAKFFKAITGEEMTQEKLDLAAERIFTLHRAYTVKLMQTKDMRNEHDLICSW
VFDKDPQIPVFTEGTDKMDRDDMHASLTMFYKEMGWDPQLGSPTRETLQRLGLEDIAADL
AAHNLLPV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagtccggaaacctgtgtggcggctattggtcaggctggggaaaaccttgttcct
ctctctggcatgttgaatagccgtaaccacagcggcggtgcgggaactggcgcaattatg
ggttcgaaaaacctgaaagcgattgcggttgaagggacgaaaggggtcaacattgccgat
cgtcaggagatgaagcgtctcaacgattacatgatgactgaacttattggtgcgaataac
aaccatgtcgtgccaagtacgccgcaatcgtgggcagagtattcagatcccaagtcacgt
tggacagcacgtaaagggctgttttggggcgcggctgaaggtggtccgattgaaacgggg
gaaattccgccaggcaatcagaacacggtcggctttcgtacctataaatccgtttttgac
ttaggtccggcggcagagaaatacacagtaaaaatgagtggctgccactcttgcccgatc
cgttgtatgacccaaatgaatattcctcgggtgaaagagtttggcgtgcccagcacaggt
ggtaacacttgtgtagccaactttgtccataccaccatctttccgaacggtccgaaagat
tttgaagataaagacgatggccgtgtgattggtaacttggttggtctgaatttgttcgat
gactacggcctatggtgtaactacgggcagttgcatcgcgactttacttattgttacagc
aaaggggtgttcaagcgtgttctgcctgctgaagagtatgcggaaattcactgggatcaa
ctggaagcgggtgacgttaatttcattaaagatttttactaccgtctggcgcatcgtgtg
ggtgagctgagtcacctggctgatggttcatatgccatcgcagaacgctggaatttgggt
gaagagtactggggctacgcgaaaaataaactctggtcgccgtttggctatccggttcac
catgccaatgaagcgtcagcgcaggtcggttccattgttaactgtatgttcaaccgtgac
tgcatgacacatacccatatcaactttattggttccggcttgccattgaaactgcaacgt
gaagtggcgaaagagctttttggttctgaagatgcctacgatgaaaccaaaaactacacg
ccaatcaatgacgcaaaaattaaatatgctaagtggtcgctgttgcgggtctgtttgcat
aacgccgtcaccctgtgtaactgggtctggccaatgaccgtttcgccgctgaaaagccgt
aattaccggggcgatctggcgcttgaagccaaattcttcaaagcgatcaccggcgaagag
atgactcaggaaaaattagatttagctgcagagcgtatctttacgttgcatcgtgcctac
acggtaaaacttatgcaaaccaaagatatgcgtaatgaacacgatcttatctgttcctgg
gtattcgacaaggatccgcagatcccggtctttactgaaggtactgacaaaatggatcgt
gacgatatgcatgcttcgctcacgatgttctacaaagaaatgggctgggacccacagctt
ggtagtcccacccgcgaaacattgcagcgtctggggctggaagatattgccgccgatctg
gcagcacacaatctactgcctgtgtaa

DBGET integrated database retrieval system