KEGG   Shigella boydii CDC 3083-94: SbBS512_E2023Help
Entry
SbBS512_E2023     CDS       T00700                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sbc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1843131..1843772
Genome map
AA seq 213 aa AA seqDB search
MPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtaccggaaggtgacagtacggtggaggttgctaaccgccttattgactggtgc
cagtcgcgcggagaagcggttatcgccagccaggactggcatccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aaccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccccaggacagtgcacacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacacaggggtaa

DBGET integrated database retrieval system