KEGG   Shigella boydii CDC 3083-94: SbBS512_E2276Help
Entry
SbBS512_E2276     CDS       T00700                                 

Gene name
lpxL
Definition
lipid A biosynthesis lauroyl acyltransferase (EC:2.3.1.-)
Orthology
K02517  
lipid A biosynthesis lauroyl acyltransferase [EC:2.3.1.-]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SbBS512_E2276 (lpxL)
Enzymes [BR:sbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     SbBS512_E2276 (lpxL)
Lipopolysaccharide biosynthesis proteins [BR:sbc01005]
 Lipid A
  SbBS512_E2276 (lpxL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2067856..2068776
Genome map
AA seq 306 aa AA seqDB search
MTNLPKFSTALLHPRYWLTWLGIGVLWLVVQLPYPVIYRLGCGLGKLALRFMKRRAKIVH
RNLELCFPEMSEQERRKMVVKNFESVGMGLMETGMAWFWPDRRIARWTEVIGMEHIRDVQ
AQKRGILLVGIHFLTLELGARQFGMQEPGIGVYRPNDNPLIDWLQTWGRLRSNKSMLDRK
DLKGMIKALKKGEVVWYAPDHDYGPRSSVFVPLFAVEQAATTTGTWMLARMSGACLVPFV
PRRKPDGKGYQLIMLPPECSPPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPE
GVPSRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatctacccaagttctccaccgcactgcttcatccgcgttattggttaacctgg
ttgggtattggcgtactttggttagtcgtgcaattgccctacccggttatctaccgcctc
ggttgtggattaggaaaactggcgttacgttttatgaaacgacgcgcaaaaattgtgcat
cgcaacctggaactgtgcttcccggaaatgagcgaacaagaacgccgtaaaatggtggtg
aagaatttcgaatccgttggcatgggcctgatggaaaccggcatggcgtggttctggccg
gaccgccgaatcgcccgctggacggaagtgatcggcatggaacacattcgtgacgtgcag
gcgcaaaaacgcggcatcctgttagttggcatccattttctgacactggagctgggtgcg
cggcagtttggtatgcaggaaccggggattggcgtttaccgcccgaacgataatccactg
attgactggctacaaacctggggccgtttgcgctcaaataaatcgatgctcgaccgcaaa
gatttaaaaggcatgattaaagccctgaaaaaaggcgaagtggtctggtacgcaccggat
catgattacggcccgcgctcaagcgttttcgtcccgttatttgccgttgagcaggctgcg
accacgaccggaacctggatgctggcacggatgtccggcgcatgtctggtgcccttcgtt
ccacgccgtaagccagatggcaaagggtatcaattgattatgctgccgccagagtgttct
ccgccactggatgatgccgaaactaccgccgcgtggatgaacaaagtggtcgaaaaatgc
atcatgatggcaccagagcagtatatgtggttacaccgtcgctttaaaacacgcccggaa
ggcgttccttcacgctattaa

DBGET integrated database retrieval system