KEGG   Shigella boydii CDC 3083-94: SbBS512_E2580Help
Entry
SbBS512_E2580     CDS       T00700                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SbBS512_E2580
   00500 Starch and sucrose metabolism
    SbBS512_E2580
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SbBS512_E2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2382308..2383591
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccacccgatcaacgtccttctgatcaaactgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgctgcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggcactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgtaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatgtccctgctgctccgggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatgggggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggc
gatagcgtagatgcaggtaaccatccggcggtggcactgcgtactgatggtgaccaggta
cagattaacaacgttaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccgcgtacgctggtgaccaacagctacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgctttcggtgatggtgtg
gcgcaactgggccgctcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacggctaaaccgtgggccgatgcggtgatctct
aatcgtccgtttgcgggtaataccggcagcgtagatgataacgacgaaatacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagtaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system