KEGG   Shigella boydii CDC 3083-94: SbBS512_E2929Help
Entry
SbBS512_E2929     CDS       T00700                                 

Gene name
pdxJ
Definition
pyridoxine 5'-phosphate synthase (EC:2.6.99.2)
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SbBS512_E2929 (pdxJ)
Enzymes [BR:sbc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     SbBS512_E2929 (pdxJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2736111..2736842)
Genome map
AA seq 243 aa AA seqDB search
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRI
LRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC
KRLTDAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELVRIAKAAT
FAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLE
ARG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattactgttaggcgtcaacattgaccatattgcaacgctgcgtaacgcacgc
ggtactgcttacccggatccggtgcaggcggcgtttattgccgagcaggcgggagcggac
ggcattaccgtgcatttacgtgaagatcgccgccacattactgaccgcgatgtgcgcatc
ctgcggcagacgctggatacccgaatgaatctggagatggcagtgaccgaagagatgctg
gcgatcgccgttgagacgaagccacatttttgctgcctggtaccggaaaagcgtcaggaa
gtaacaaccgaaggcggcctggacgttgcagggcagcgtgaaaaaatgcgcgatgcctgc
aaacgtctgacagatgccgggattcaggtttctctctttatcgacgccgatgaagagcag
atcaaagctgcggcagaggttggcgcaccgtttatcgagatccacaccggttgctatgct
gatgccaaaactgacgccgaacaggcgcaagagctggtgcgtatcgccaaagccgcgacc
tttgccgctagtctcggtctgaaagttaacgccggacacggtctgacctatcacaacgtg
aaagccattgccgccatccctgagatgcatgaactgaatatcggtcatgccattattggc
cgtgcagtgatgaccggactgaaagatgcggtggcagaaatgaagcgtctgatgctggaa
gcgcgtggctaa

DBGET integrated database retrieval system