KEGG   Shigella boydii CDC 3083-94: SbBS512_E3016Help
Entry
SbBS512_E3016     CDS       T00700                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SbBS512_E3016
   00630 Glyoxylate and dicarboxylate metabolism
    SbBS512_E3016
   00640 Propanoate metabolism
    SbBS512_E3016
   00650 Butanoate metabolism
    SbBS512_E3016
  Lipid metabolism
   00071 Fatty acid degradation
    SbBS512_E3016
   00072 Synthesis and degradation of ketone bodies
    SbBS512_E3016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SbBS512_E3016
   00310 Lysine degradation
    SbBS512_E3016
   00380 Tryptophan metabolism
    SbBS512_E3016
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SbBS512_E3016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SbBS512_E3016
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SbBS512_E3016
Enzymes [BR:sbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SbBS512_E3016
Exosome [BR:sbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SbBS512_E3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2811802..2812983
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPCTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtttggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaatagcgtttct
gcaatcactattaatgacgtttgcggttctgggcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccatgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system