KEGG   Shigella boydii CDC 3083-94: SbBS512_E3040Help
Entry
SbBS512_E3040     CDS       T00700                                 

Gene name
recC
Definition
exonuclease V subunit gamma (EC:3.1.11.5)
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SbBS512_E3040 (recC)
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SbBS512_E3040 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2836011..2839379
Genome map
AA seq 1122 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
DFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEHEDFTLLRHYLTDDSD
KRKLFQLSSKAADLFDQYLVYRPEWLAQWETGHLVEGLGEAQAWQAPLWKALVEYTHELG
QPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLF
TNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVDNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSR
SDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFDITEEGLRYLRHWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWHRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQKPKRGDRSRRDDDRYLFLEAL
ISAQQKLYISYIGLSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHL
TCLHTRMPFDPQNYQPGERQSYAREWLPAASRAGKAHSEFVQPLPFTLPETVPLETLQRF
WAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGVQITGWLPQVQ
PDGLLRWHPSLLSVAQGMQLWLEHLVYCASGGNGESRLFLRKDGEWRFPPLAAEQALHYL
SQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAMLDDDSTLQKARTKFLQAYEGNMM
VRGEGDDIWYQRLWRQLTPETMEAIVEQSQRFLLPLFRFNQS
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccattccaatcgtctggacgtgctggaagcgttgatggagtttatt
gtcgaacgcgaacggctggacgatcctttcgaaccagagatgattctggtgcaaagtacc
ggtatggcacagtggctgcaaatgaccctgtcgcaaaagtttggtattgcggcaaacatt
gattttccgctgcctgcgagctttatctgggatatgttcgtccgggtgttaccggagatc
cccaaagagagcgcctttaacaaacagagcatgagctggaaactgatgactctgctgcca
caactgttggagcacgaagactttaccctgttgcggcattatctgactgacgatagcgac
aagcgaaaactgttccagctttcctcaaaagcggcggacctgtttgaccagtatctggtc
tatcgcccggagtggctggcacaatgggaaacaggacatttggttgaagggctgggagaa
gcacaggcctggcaagcgccgttgtggaaggcgctggtggaatatacccatgaactcgga
caaccgcgctggcaccgcgcgaatctctatcagcgctttatcgaaacgctggagtccgcg
acgacctgcccgccggggttaccttcgcgcgtctttatatgcggtatttccgcgttaccg
cctgtttatctccaggcgctccaggcgctgggtaaacatattgaaatccatctcctgttt
accaacccctgccgttattactggggcgatattaaagatcctgcttatctggcgaaactg
ctgactcgtcagcgtcgacacagttttgaagatcgcgaattgccgctatttcgcgatagc
gaaaatgccggacagctctttaacagcgatggtgaacaggatgtcgacaacccgctgctg
gcctcatgggggaagcttgggcgcgactacatttatctcctttctgacctggagagcagc
caggagctggacgcctttgtcgatgtcacgccagataacctgctgcataacattcagtct
gacattctggaactggaaaaccgtgccgttgctggtgtgaacatcgaagagttttcccgt
agcgataacaaacgcccgcttgatccactggatagcagtatcaccttccacgtttgccat
agcccgcagcgtgaagttgaagttttgcacgatcgcctgctggcgatgctggaagaagac
ccgacacttactccgcgcgacatcatcgtgatggtggctgatatcgacagctacagtccg
tttattcaggctgtgtttggtagcgcacctgcggatcgttacctgccttacgccatttcc
gaccgtcgggcgcggcagtcgcatccggtactggaagcgtttatcagcctgttatcgttg
ccagacagccgctttgtgtcggaagacgtgctggcattactggatgtgccggtgctggcg
gcgcggtttgacatcaccgaagaagggctgcgttatttacgccactgggtcaacgaatcc
ggcattcgttgggggatagatgacgacaacgttcgcgagctggaactccccgccaccgga
caacacacctggcgatttggcctgacgcgtatgttgctgggctacgcgatggagagcgcg
cagggcgagtggcaatcggttctaccttatgatgagtcgagcggcttaattgcagaactg
gtggggcatctggcttcactgctaatgcagctaaacatctggcatcgcgggctggcacag
gagcgtccgctagaagagtggttgccggtttgtcgcgatatgctcaacgccttcttcctg
ccggatgcggaaaccgaagcggcgatgacgctgatcgaacaacaatggcaggcgattatc
gccgaaggtttaggtgcgcagtatggcgacgcggtgccgctgtcactattgcgtgatgaa
ctggcacagcgtctggatcaagaacgtatcagccagcgttttctcgccggaccggttaac
atttgtactctgatgccaatgcgttcaattccgttcaaagtggtttgcctgctgggaatg
aacgacggcgtttatccacgtcagcttgcgccattgggctttgacctgatgagccagaaa
ccgaagcgtggcgaccgtagccgtcgcgatgacgaccgctacctgttcctggaagcgtta
atttccgcgcagcaaaaactctatatcagttatatcgggctttccattcaggataacagt
gaacgtttcccgtcggtactggtgcaggaactgatcgactacatcgggcaaagtcattat
ctaccgggcgatgaagcgctcaactgtgatgaaagcgaggcaagggtaaaagcgcatctt
acctgcctccatacccggatgccgtttgatccacaaaactaccagccaggcgaacgacaa
agctatgctcgtgaatggctacctgcggccagccgggctggtaaagcacattctgaattt
gttcagccgctgccgtttaccttaccggaaaccgtgccgctggaaacgctacaacgattc
tgggcacatccggtgcgggcatttttccagatgcgtttgcaggtgaacttccgtaccgaa
gacagcgaaatccccgacaccgagccatttattctggaagggcttagccgttatcaaatc
aatcagcagttattgaatgcactggttgagcaggatgatgccgaacgcttgttccgtcgc
ttccgggcggcaggggatttaccgtatggcgcttttggtgaaattttctgggaaactcag
tgccaggagatgcagcagcttgccgacagagtcattgcctgtcgccagccggggcagagt
atggaaattgatctcgcctgcaacggtgtgcagataactggctggttgccgcaggtgcag
ccggatggcctgttgcgctggcatccctctttattaagtgtggcgcagggaatgcaactt
tggctggaacaccttgtctactgtgccagcggtggtaatggtgaaagtcgcctttttcta
cgcaaagacggcgagtggcgttttccgccgcttgcagccgaacaggctttgcattacctc
tcacaactgattgaggggtatcgtgaagggatgtccgcgccattgctggtgttacctgaa
agtggcggcgcgtggctaaaaacctgttatgacgcgcaaaacgatgccatgctggatgac
gattccacgttgcaaaaagcccgtacgaaattccttcaggcttacgaaggcaacatgatg
gtgcgtggcgaaggtgatgatatctggtatcaaaggctctggcggcaattaacaccagag
acaatggaggccatcgttgaacagtcgcaacgtttcctgttaccgctgtttcgctttaat
cagtcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system