KEGG   Shigella boydii CDC 3083-94: SbBS512_E3069Help
Entry
SbBS512_E3069     CDS       T00700                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sbc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2865647..2865844)
Genome map
AA seq 65 aa AA seqDB search
MYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEV
LQERL
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgtactcggtaatggcgaactggggcgctaaccatggggttctgaccatcggccacgtt
ggcgctgactttatcactctcgcctccatgctgcgtatcccggtatgtatgcacaacgtt
gaagagaccaaagtgtatcgtccttctgcctgggctgcgcacggcatggatattgaagta
ttgcaggagcgattatga

DBGET integrated database retrieval system