KEGG   Shigella boydii CDC 3083-94: SbBS512_E3131Help
Entry
SbBS512_E3131     CDS       T00700                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sbc  Shigella boydii CDC 3083-94
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922756..2923382
Genome map
AA seq 208 aa AA seqDB search
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagacgcgtacaagcacttctggatcaattacgtgcgcaaggtattcaggat
gagcaggtgctgaatgcacttgctgccgtgccgcgtgaaaaattcgttgatgaagcgttt
gaacaaaaagcctgggacaatatcgccttgccgataggtcaggggcagacaatttcgcag
ccgtatatggtagcgcgaatgaccgaattactcgagctgacgccgcagtcgcgggtgctg
gaaattggcaccggttcgggatatcaaacggcaatcctggcgcatcttgtccagcatgtt
tgctcggtcgaacggattaaaggtttgcagtggcaggcgcgtcgccgcctgaaaaatctt
gatttacataatgtttcaacccgtcatggcgatggatggcaaggttggcaggcacgcgcg
ccgtttgacgctatcattgttacggcggcaccgccggaaattccaactgcgctaatgacg
cagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtatttgaaa
cgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgctttgtc
cctttagtgaagggggagctggcttaa

DBGET integrated database retrieval system