KEGG   Shigella boydii CDC 3083-94: SbBS512_E3937Help
Entry
SbBS512_E3937     CDS       T00700                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SbBS512_E3937 (bcsZ)
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SbBS512_E3937 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3669983..3671080)
Genome map
AA seq 365 aa AA seqDB search
MRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFF
ALAANDRAAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVWMAW
SLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYL
PPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYD
AIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAA
MLPFLQNRDAQVVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQE
CANSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtagtggaatcgtgacgatgctgttgttggctgcctttagtgttcaggcagcctgt
acctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaagggcgcgtcatc
gaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggtatgttcttt
gccctggcggctaacgaccgtgcagctttcgataatattctcgactggacgcagaacaat
ctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaagaaagagaac
agtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctggatggcctgg
tcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatcggcagcgcg
ttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggttccatgttg
ttaccgggcaaagtgggttttgctgaggataacagctggcgttttaaccccagctacctg
ccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggactacgctgcgcgaa
accaatcaacgtttattgctggaaaccgccccgaaaggcttttcgccagactgggtgcgt
tatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagcagctacgac
gccatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcagaaagcgcgg
atgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttatccgccggaa
aaagtggatgtggctacggggaaagcgcagggtaaaggaccagtcggtttttctgccgcc
atgctgccctttttacaaaaccgcgatgcgcaggtcgttcagcgccagcgcgtggccgat
aactttcccggcagcgatgcctattacaactatgtgctgaccctgtttggacaaggctgg
gatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactggggccaggaa
tgcgcaaattcacactaa

DBGET integrated database retrieval system