KEGG   Shigella boydii CDC 3083-94: SbBS512_E4099Help
Entry
SbBS512_E4099     CDS       T00700                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00230  Purine metabolism
sbc01100  Metabolic pathways
Module
sbc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SbBS512_E4099 (gmk)
Enzymes [BR:sbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SbBS512_E4099 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 AAA_16 AAA_22 ABC_tran AAA_33 AAA_18 AAA_29 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ACD07118
UniProt: B2TTX8
Position
3821783..3822406
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHD
EFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacacc
acacgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgat
gaatttaaagaaatgattagcagagatgcgttcctcgaacacgcagaagtttttggtaat
tactatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgttttt
ctcgatatcgactggcagggcgcgcagcaaattcgccagaagatgccgcacgcgcggagt
atctttattttaccgccgtctaaaattgaactggaccgccgtctacgcggtcgcggtcag
gacagcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattac
gccgaatatgattacctgattgtgaatgatgacttcgataccgcgttgaccgatttgaag
accattattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system