KEGG   Shigella boydii CDC 3083-94: SbBS512_E4556Help
Entry
SbBS512_E4556     CDS       T00700                                 

Gene name
plsB
Definition
glycerol-3-phosphate acyltransferase (EC:2.3.1.15)
Orthology
K00631  
glycerol-3-phosphate O-acyltransferase [EC:2.3.1.15]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbc00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4257849..4260272
Genome map
AA seq 807 aa AA seqDB search
MSGWPRIYYKLLNLPLSILVKSKSIPADPAPELGLDTSRPIMYVLPYNSKADLLTLRAQC
LAHDLPDPLEPLEIDGMLLPRYVFIHGGPRVFTYYTPKEESIKLFHDYLDLHRSNPNLDV
QMVPVSVMFGRAPGREKGEVNPPLRMLNGVQKFFAVLWLGRDSFVRFSPSVSLRRMADEH
GTDKTIAQKLARVARMHFARQRLAAVGPRLPARQDLFNKLLASRAIAKAVEDEAHSKKIS
HEKAQQNAIALMEEIAANFSYEMIRLTDRILGFTWNRLYQGINVHNAERVRQLAHDGHEL
VYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAGPIFRRLGAFFIRRTFKGNK
LYSTVFREYLGELFSRGYSVEYFVEGGRSRTGRLLDPKTGTLSMTIQAMLRGGTRPITLI
PIYIGYEHVMEVGTYAKELRGATKEKESLPQMLRGLSKLRNLGQGYVNFGEPMPLMTYLN
QHVPDWRESIDPIEAVRPAWLTPTVNNIAADLMVRINNAGAANAMNLCCTALLASRQRSL
TREQLTEQLNCYLDLMRNVPYSTDSTVPSASASELIDHALQMNKFEVEKDTIGDIIILPR
EQAVLMTYYRNNIAHMLVLPSLMAAIVTQHRHISRDVLMEHVNVLYPMLKAELFLRWDRD
ELPDVIDALANEMQRQGLITLQDDELHINPSHSRTLQLLAAGARETLQRYAITFWLLSAN
PSINRGTLEKESRTVAQRLSVLHGINAPEFFDKAVFSSLVLTLRDEGYISDSGDAEPAET
MKVYQLLAELITSDVRLTIESATQGEG
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctggccacgaatttactacaaattactgaatttaccattaagcatcctggta
aaaagcaagtctattccggcagatcctgccccggaactggggctggatacctctcgtcca
attatgtacgttttaccgtacaactcgaaagcagatttgctgacgttacgcgcccagtgt
ctggctcatgacttgcctgacccgttagagccgctggaaatcgacggcatgctactgccg
cgctatgtgttcattcacggcgggccgcgtgtattcacctattacacgccgaaagaagag
tctattaagctgttccacgactatctcgatttgcaccgtagcaacccaaatctggatgtg
cagatggtgccagtatcggtgatgtttggtcgcgcgccggggcgtgaaaaaggcgaagta
aacccgccgctgcgtatgcttaacggcgtacagaaatttttcgccgtactgtggctcggt
cgcgacagttttgtgcgtttctcgccgtcagtttcgctgcgccgtatggcggatgaacac
ggcacggataaaactatcgcacagaaactggcgcgcgtggcgcgtatgcactttgcccgt
caacgtctggctgctgtgggcccacgtctgcctgctcgtcaggatctgtttaataagctg
ctcgcctcccgcgccattgccaaagcggtagaagatgaagcgcacagcaaaaaaatctcc
catgaaaaagcgcagcagaacgcgattgcgctgatggaagagattgcggcgaatttctct
tacgagatgatccgcctgactgaccgcattctgggcttcacctggaaccgactttatcag
ggcatcaacgtccataacgccgagcgcgttcgccagctggcccacgacggtcatgagctg
gtgtatgtgccttgccaccgcagtcacatggactacctgctactttcttacgtgctgtac
caccaggggctcgtgccgccgcatatcgccgccgggatcaacctgaatttctggccggcc
gggccgattttccgccgtctgggggcgttctttattcgccgtacgtttaaaggcaataaa
ctttattccaccgttttccgtgagtatctcggcgaactgttcagccgtggttattccgtc
gagtatttcgtggaaggcggtcgttcccgtacggggcgtttgctggatccgaaaaccggt
acgctgtcgatgaccattcaggcgatgctgcgtggcggcacgcgtccgattacgctgatt
ccgatctatatcggttatgagcacgtcatggaagtggggacttacgccaaagaactgcgc
ggtgcgacgaaagagaaagagagcctgccgcagatgctgcgcggtttaagcaagctgcgt
aatctcggtcagggttacgtcaacttcggtgaaccaatgccgttgatgacctaccttaac
cagcatgtacctgactggcgtgaatctatcgatcccatcgaagcggtgcgtccggcatgg
ttaacgccgacggtcaataatattgctgccgatctgatggtacgcattaacaacgcaggc
gcggcaaacgccatgaacctctgctgtaccgcgctactggcatcacgtcagcgctcactt
acccgcgagcagttaaccgagcaactcaactgctacctggatctgatgcgcaacgtacct
tactccacggactctaccgttccttcagccagcgccagcgagcttatcgatcacgcgctg
caaatgaacaagtttgaagttgagaaagacactatcggcgacatcatcattctgccgcgc
gagcaagcggtgctgatgacctactatcgcaacaacattgcgcatatgttggtgctgcct
tcgctgatggcggcaattgtcacccagcatcgccacatctcccgcgacgtattgatggag
cacgtcaatgtgctttacccaatgctgaaagcggagctgttcctgcgctgggatcgcgac
gagttgccggacgttattgatgcgttggcaaatgagatgcaacgtcaggggctgattacc
ctgcaagatgatgagttgcatatcaacccgtcgcattctcgcacgctacagctgctggcc
gcaggcgcgcgcgaaacgctgcaacgttatgccatcaccttctggctgttgagcgctaac
ccgtcgatcaaccgcggtacgctggagaaagagagccgcaccgtcgcgcaacgtctctcc
gtgctgcacggtatcaacgcgccggagttcttcgacaaggcggtgttcagttctctggtg
ctgacgctgcgtgatgaagggtatatcagcgatagcggcgatgccgaaccggcagaaacg
atgaaggtttatcagttgctggcggagttgattacatcagacgtgcgtttgacgattgag
agtgcgacgcagggcgaagggtaa

DBGET integrated database retrieval system