KEGG   Shigella boydii CDC 3083-94: SbBS512_E4929Help
Entry
SbBS512_E4929     CDS       T00700                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00240  Pyrimidine metabolism
sbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SbBS512_E4929 (deoA)
Enzymes [BR:sbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SbBS512_E4929 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ACD10053
UniProt: B2TZR5
Position
4593648..4594970
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLADKAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcactgagcgatgaa
gaaattcgtttctttatcaacggcattcgcgacaacactatctccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgacc
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccg
attgttgataaacattccaccggcggcgtcggcgatgtcacttcgctgatgttggggccg
atggtcgcagcctgcggcggctatattccgatgatctccggtcgcggcctcggtcatact
ggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccggatgacaac
cgtttccgcgaaattattaaagacgtcggcgtggcgattatcggtcagaccagctcactg
gctccggcggataaacgtttctacgcgacccgtgatattaccgcaaccgtggactccatc
ccgctgatcactgcctcgatcctggcgaagaaactggcggaaggtctggatgcgctggtg
atggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcacc
gacatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtg
cagttcctgacgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcgctgtgc
gtggagatgctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattg
caggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctgggg
atggcagtggttgcaatgggcggcggtcgtcgtcaggcatctgacaccatcgattacagc
gtcggctttactgatatggcgcgtctgggcgaccaagtagacggtcagcgtccgctggcg
gttatccacgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggca
attaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system