KEGG   Salmonella bongori NCTC 12419: SBG_0003Help
Entry
SBG_0003          CDS       T01579                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00260  Glycine, serine and threonine metabolism
sbg00750  Vitamin B6 metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01230  Biosynthesis of amino acids
Module
sbg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBG_0003 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBG_0003 (thrC)
Enzymes [BR:sbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBG_0003 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CCC29101
UniProt: A0A0K0H6V9
Position
3747..5033
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKLQGLFFPHDLPEFSLTEVDEMLNQDFVSRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVAQVESDIGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDDELKTELGLNSANSINISRLLAQICYYFEAVAQLPQDARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNINDTVPRFLQNGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDATTQQTMRELKAKGYISEPHAAVAYRA
LRDQINPGEYGLFLGTAHPAKFKESVESILGETLPLPEALAERADLPLLSHHLPADFVAL
RKLMMTHR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatctgaaagaccacaacgagcaggtcagctttgcacaggccgtcacg
caggggctgggcaaactgcagggacttttttttccgcacgatctgccggagtttagcctg
acggaagtggatgagatgctcaaccaggactttgtcagtcgtagcgcgaagatcctctcg
gcatttattggcgatgaaataccgcaggagattctggaggaacgtgtccgcgcggcgttt
gcttttccggcaccggtcgcgcaggtggaaagtgatatcggctgcctggagttgtttcac
ggcccgacgttggcgtttaaagatttcggcgggcgttttatggcgcaaatgctgacacat
atcagcggcgacaaaccggttacgattctgactgcaacgtctggcgataccggcgcggcg
gttgcccatgcgttttatggcctgaaaaatgtgcgggtcgtcattctctatccacgcggc
aagatcagcccgttgcaggaaaagctgttctgtacgctgggcggcaacatagaaactgtg
gcgattgacggcgatttcgatgcctgtcaggcgctggtaaaacaggcgtttgacgacgac
gagctgaaaacggagctggggctgaactcggctaactctattaatatcagtcgcctgctg
gcgcaaatttgctactactttgaagcggtggcgcaattgccacaggacgcgcgtaaccaa
ctggtggtctccgtccccagcggcaacttcggcgatctgactgccgggttgctggcgaag
tcgttagggctgccagtgaaacgctttatcgccgccaccaacattaacgatacggtgcct
cgtttcctgcagaacgggaagtgggcgccgaaagcgacgcaggcgaccctgtcaaatgcg
atggatgtcagtcagccgaataactggccgcgcgtggaagagctgttccgccgtaaaatt
tggcgtctgagtgaactgggctatgcggcagtagatgatgccaccacgcaacagacgatg
cgtgagctgaaagcgaaaggttatatttcggagcctcatgcggcagtagcgtatcgggca
ttgcgcgaccagataaatcctggcgagtatggcttgttcctcggaacggcgcacccggcg
aagtttaaagagagcgtggagtccattctgggggaaacgctgccgttgcctgaagcgctc
gccgaacgtgccgatctaccgttgctctcacatcatctgcctgcagattttgtcgctctg
cgtaaactgatgatgacccaccgataa

DBGET integrated database retrieval system