KEGG   Salmonella bongori NCTC 12419: SBG_0075Help
Entry
SBG_0075          CDS       T01579                                 

Gene name
folA
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sbg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82779..83258
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVRSVDEAIAACGNAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccattgggcgtccgttaccagggcgtaaaaatatt
gtcatcagtagccaaccgggcaccgacgatcgcgtgcagtgggtgaggtctgttgatgag
gcgatagccgcatgtggcaatgcgccagaaattatggtcattggcggtgggcgtgtgtat
gagcagtttttgcccaaagcgcagaagctttatctgacgcatattgacgcggaagttgaa
ggcgatacccattttccggattatgaaccggatgactgggagtcggtattcagcgaattt
catgatgccgatgcgcagaactctcatagctattgtttcgagattctggagcgtcgctaa

DBGET integrated database retrieval system