KEGG   Salmonella bongori NCTC 12419: SBG_0148Help
Entry
SBG_0148          CDS       T01579                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg00020  Citrate cycle (TCA cycle)
sbg00620  Pyruvate metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
Module
sbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_0148 (aceF)
   00020 Citrate cycle (TCA cycle)
    SBG_0148 (aceF)
   00620 Pyruvate metabolism
    SBG_0148 (aceF)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SBG_0148 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23 DUF1223
Motif
Other DBs
NCBI-ProteinID: CCC29244
UniProt: A0A0K0H6V5
Position
166041..167930
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVNVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTETGKLIMIFDSADGAADAAPAPAEEKKEAPAAAPASAAAKDVHVPDIGSDEVEVT
EIMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMVFDVAG
EAGAAAPAAAKAEAAPAAAPAATGAKDVNVPDIGGDEVEVTEVMVKVGDKVEAEQSLITV
EGDKASMEVPAPFAGTVKEIKINTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPAA
KAEQPAAAPVAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAESAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaggtaccggacatcggggcagatgaagttgaaatcaccgagatc
ctggtcaacgtaggcgacaaggttgaagctgaacagtcgctgatcaccgtagaaggcgat
aaagcctctatggaagtcccgtcgccgcaggctggtatcgttaaagagattaaagtctct
gttggcgataaaaccgagactggcaaactgattatgattttcgattccgccgacggtgca
gctgacgctgcgccggctccggcagaagagaagaaagaagcgccggcagcggcaccggcg
tctgcggcggcaaaagacgttcacgtgccggatatcggcagcgacgaagttgaagtcact
gagattatggtcaaagtgggcgataccgttgaggctgaacagtcgctgatcaccgtcgaa
ggcgataaagcgtcgatggaagtcccggcgccgtttgcgggcaccgtcaaagagatcaaa
atcaacaccggcgataaagtgtctaccggctcgctgatcatggtcttcgacgtagcgggc
gaagcaggcgctgcggcaccggctgcggcgaaggccgaagcagcgccggcggcagccccg
gcagccactggcgcgaaagacgtcaacgttcccgatatcggcggcgatgaagttgaagtc
accgaagtcatggtgaaagtcggcgataaagtggaagctgaacagtcgctgatcaccgtg
gaaggtgataaggcgtcaatggaagtgccggcgccgttcgcaggcaccgtaaaagagatc
aaaatcaataccggcgataaagtaaaaactggctcgctgattatggtctttgaagtggaa
ggcgcagcgcctgccgccgctccggctaagcaggaagccgccgctccggcgccagctgcg
aaagctgagcagcctgcagcggccccggttgccaaagcggaaggtaaatctgagtttgct
gaaaatgacgcttacgttcatgccactccgctgatccgccgcctggcgcgcgagttcggc
gttaacctggcgaaagtgaaaggcaccggtcgtaaaggtcgtatcctgcgtgaagacgtt
caggcttacgtgaaagacgcgattaagcgtgcggaatctgcaccagcggctgctggcggt
ggtatcccgggcatgttgccgtggccgaaagtcgacttcagcaagtttggtgaagtcgaa
gaagtagagctgggtcgtatccagaaaatctctggtgctaacctgagccgtaactgggtg
atgatcccgcacgttacccacttcgacaaaaccgatatcaccgatctggaagcattccgt
aaacagcagaacgctgaagctgagaagcgcaaactggatgtgaaatacaccccagtggtc
ttcatcatgaaagcggttgccgctgcactggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgacgctgaagaaatacatcaacatcggcgtcgcggtggat
acaccgaatggtctggtcgttccggtattcaaagacgtgaacaagaagagtgttactgag
ctgtctcgcgaactgaccaccatctccaaaaaagcgcgtgacggtaagctgactgctggc
gagatgcagggcggttgctttactatctccagcatcggcggcctgggcaccacccacttt
gcgccgattgtgaacgcacctgaagtcgctatccttggcgtgtccaagtcggcgatggaa
ccggtgtggaacggtaaagagtttgtaccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtaatcgacggtgctgatggtgcacgtttcattaccatcattaataacatg
ctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system