KEGG   Salmonella bongori NCTC 12419: SBG_0211Help
Entry
SBG_0211          CDS       T01579                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00900  Terpenoid backbone biosynthesis
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01130  Biosynthesis of antibiotics
Module
sbg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SBG_0211 (dxr)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SBG_0211 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CCC29307
UniProt: A0A0K0H7J4
Position
241128..242324
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPDSFRVVALVAGKNVARMAEQCLAFSPRYAVMDDAP
SAEQLKRMLQQHGCRTEVLSGQQAACEMAALDEVGYVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHHLGYADLEQNGVTS
ILLTGSGGPFRETPMRDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFC
KLSALTFSAPDYQRYPCLKLAMDAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLN
LAVLERMDLQEPASVDDVLQVDAIARDVARKQVIRLSR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccattctgggctcgaccggctctattggttgcagcacactggacgtg
gtgcgccataaccctgatagcttccgcgttgtcgcgctggttgcgggtaaaaatgttgcc
cgtatggcggagcagtgcctggcgttttcgccgcggtatgccgtaatggacgatgcaccg
agcgcagaacagctcaaaagaatgcttcaacagcatggctgtcgtaccgaggttctgagc
ggacaacaggccgcttgcgagatggcggcgcttgatgaggtcggatatgtgatggcggcc
attgtcggcgccgctggtttactaccgaccctggcagcgattcgtgcaggaaagactatc
ctgctggccaataaagaatcgttggtaacctgcgggcggctgtttatggatgaagtgaaa
cgcagcaacgcccggcttttacccgtcgatagcgaacataacgcgatttttcagagtttg
ccgcaatctattcagcatcatctgggatacgctgatctggagcaaaatggcgtcacgtcg
attttgcttaccgggtctggtggcccgttccgtgaaacgcccatgcgcgatctggcggcg
atgacgccggatcaggcatgtcgtcatccgaactggtcgatggggcgaaaaatctccgtc
gactctgccaccatgatgaataaaggtctggaatacattgaagcgcgttggttatttaat
gccagcgcacgtcagatggaagtgttgatccatccgcaatcggttattcattcaatggtg
cgttatcaggacggcagcgtccttgcgcagcttggagagcctgacatgcgtacgcctatt
gcgcacacgatggcatggccgaatcgcgtcacgtccggcgcgcagccgctcgatttttgc
aaactcagcgcgctgacgtttagtgcgcccgattatcagcgttatccgtgtctgaagctg
gcgatggacgcgtttgagcagggtcaggcggcaacgacggcgctcaatgcggcaaacgaa
atcacggtggctgcgtttctggcgcaacagattcgttttaccgatatcgccgggctcaat
ttagcggtgctggagcggatggatttacaggaaccggcaagcgttgatgacgtattgcag
gtcgacgccatcgcgcgtgacgttgccagaaaacaagtgatacggctctcacgctga

DBGET integrated database retrieval system