KEGG   Salmonella bongori NCTC 12419: SBG_0313Help
Entry
SBG_0313          CDS       T01579                                 

Gene name
res
Definition
type III Restriction-modification system enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SBG_0313 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361389..364358
Genome map
AA seq 989 aa AA seqDB search
MNILLEELPHQEQALAAILASFTGIDYTQADHNHYSNPLINGRYDDKTNIDVKMETGTGK
TYVYTRLMYELHQQYGLFKFVLVVPTPAIKEGARNFIISDYARQHFSQFYENTQMELCTI
NAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGL
TSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCV
RKDYYRRKPQFDLNAVDSFNDGLVKGIDIYYPNLPEDQAKNRYIVDSVTAKKLVLRQGSK
IEEVGVGENLADVDAGFEGNIVYVGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAID
KHFDTEQVNFLRSNERENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQLI
ETYQGKTLPREVEYLSFLQATLASLHSANQNVHAGYFGEDRGSGDEAIQAEVDDILKNKE
KLLSFTDRHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPV
DENGHRVQQEEWPSRLAFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDDAMIKLIVTER
QKIDPTFTELRLLEDLDDKNLINRSNEFKPSVTLNGETKSGFAWLLEFYSELTQARVRAD
RIRDNKPASRLRVRLRKENWEQLRGVWEAFSRRYMLQFERSSSSLEQIAAEVLRDPALYV
RQKPSQMQQRLVSSEDNNRFEVAQREGELASSEFMAGMKYGHFLKQLVLRTSLPVNVLHP
VLMAMLRDVLQGDSRYLSEISLNNIARALLAHINDHFAQRHDYLPLNFQASTSVFDSTTR
QFREEISAEIVGKNVDVNAIDDHRSLYQLPPLRYDSVDPELPLLKHDYPQQVSVFGKLPR
RAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDKVILDAQRKFFDMLRR
QNINIEFSEATSAPAVFSTINDLIAGKTN
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcttactggaagaacttccccatcaggagcaggcgttagcagcaattctggcg
agttttactggcattgattacacgcaggccgatcataatcactactcgaatccattgatt
aacgggcgctacgacgataagaccaatattgatgttaaaatggagaccgggacgggtaaa
acctatgtgtatacccggctgatgtatgaactacatcagcaatatggcctctttaaattt
gtgctggtggtgccgaccccagccattaaagaaggcgcgcggaattttatcatcagcgat
tatgcccgacagcacttttcacagttctatgaaaatacgcagatggaattgtgtactatc
aatgcgggtgattttaaagtgaagtcggggcgcaaaaatttcccggcccagctattaagt
tttaccgatgccagtcgtcgcgatagccatacgattcaggttttactgatcaatgcgcaa
atgctaaattctgccagtatgacgcgagacgattacgatcaaacgctgctgggcgggttg
acgtcgccagttaaagggctgcaaatgacgcggcctgtcgtcattattgatgaaccgcat
cgttttgcgcgagataacaaattctacagagcgattcaggccattcagccacaaatgatc
gtgcgttttggcgccaccttcccggatattgttgaaggcaagggtaaaaataaatgcgtt
cgtaaagattattaccgacggaaaccgcagtttgacctcaatgcggtagatagttttaac
gatggtctagtgaagggcattgatatttattaccctaatctccctgaagatcaggccaaa
aatcgttatattgttgatagcgtcacggcaaagaaattagttctccgacaggggagcaaa
attgaagaggtcggtgtgggcgaaaatctcgccgatgtcgatgcgggatttgaaggtaat
attgtatatgtcggcagtaaaatgttgtcgaacgatctggagctggaagcgggaatggct
ctggtgcctggaacttttggcgcgagctatcaggaactgattatacaggatgctatcgat
aagcatttcgacaccgagcaggtaaatttcttacgcagtaatgagagagaaaataatgct
ccgcgaattaaaacgttaagccttttctttattgatagcattaaaagttatcgtgatgat
gaaggctggttgaaagtcacgtttgagcgtttgctgaaaaagaaactgacgcaactgatt
gagacctatcaaggtaagacattgccgcgtgaagtggagtatctgtcattcctgcaggcc
acgcttgccagcctgcattccgctaatcaaaacgtccacgccggttattttggcgaagac
cggggcagcggcgatgaggcaatccaggcagaagtcgatgatattctgaaaaataaagaa
aagttgcttagttttacagaccgtcacggcaactgggaaacgcgtcgctttctgttttca
aaatggacgcttcgcgaaggctgggataatccgaatgtttttgtcattgccaaattacgc
tcttccggaagtgagtcgagcaaaattcaggaagtgggacgcggtctgcggttaccggtg
gatgaaaacggtcatcgcgttcagcaggaagagtggccgtcccggctggcgtttctgatt
ggttatgatgaaaaagcgtttgccagtatgttggtcgatgagattaaccgcgacagcaag
gttcagctcaatgagcagaaactggatgatgcgatgatcaaactcattgtcactgagcgg
cagaaaattgaccctacctttacagagcttcgtttgctggaagatctggatgataaaaac
ctcatcaaccggagcaatgaatttaaacccagcgtgacgcttaacggagaaaccaaaagc
ggctttgcgtggttgctggaattttattctgagttgacgcaggcgcgcgtgcgtgcagat
cgcattcgtgacaacaaacccgcttcccgcctgcgggtcaggttacgtaaagaaaactgg
gaacaacttcgcggtgtctgggaggcgttttcccgccgttatatgttgcaattcgagcgt
agcagttcgtcactggaacagattgccgccgaggttctgcgtgacccggcgctgtatgtt
cgccagaagccgagccagatgcaacaacggttggtttcgagtgaggataataaccgcttt
gaggtggcgcaacgtgagggagaattagcctccagcgaatttatggcaggaatgaaatac
ggtcatttccttaaacagttggtgttacgcaccagtctgccggtgaacgttctgcacccg
gtgttaatggcgatgctacgcgacgttttgcagggagattcacgctatttaagcgagatc
tctttgaataatattgcgcgtgctttactggctcacatcaacgatcattttgcacagcgc
cacgactatctgcctcttaattttcaggcttcaacgtcggtgtttgattctactacccgg
cagttcagagaggaaattagcgctgaaattgtgggtaaaaatgtcgatgtgaatgcgata
gatgatcaccgttctctctaccagctaccaccgttgcggtatgacagcgtcgatcccgaa
ttgccgctattaaagcatgattatccgcagcaggtctctgtatttggcaaattgccccgg
cgggccatccagatcccgaaatacaccggcggctccaccacgccggattttgtgtaccgt
attgagcgccaggacgccgacagcgtttatttactggttgaaacgaaagcagaaaatatg
cgtgtgggtgataaagttatccttgatgcgcaacgtaaattctttgatatgctgcgtcgt
caaaatatcaatatcgaattttcggaagcaaccagcgcaccggcggttttttctacgatc
aatgacttgattgcggggaagacaaactaa

DBGET integrated database retrieval system