KEGG   Salmonella bongori NCTC 12419: SBG_0316Help
Entry
SBG_0316          CDS       T01579                                 

Definition
terminal oxidase subunit II
Orthology
K00426  
cytochrome d ubiquinol oxidase subunit II [EC:1.10.3.-]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sbg00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbg02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366255..367265
Genome map
AA seq 336 aa AA seqDB search
MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDVMVNSVAPVWDGNETW
LVMGGAGLFGAFPLAYAVIADALTIPLVIMLLGLIFRGVAFEFRFKATESHRAFWDKSFI
VGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFCGVGLVITYALLGATWLI
MKSEDPLHSRMCELSRPLLIALLLVMGGVSIWTPLTHSAIAERWFTLPNLYYFLPVPVLV
LIFSAWLWRSVKNPQSHARPFVLTLGLIFLGFSGLGISIWPNIIPPDISLYAASAPPQSQ
SFMLVGALVIIPIILAYTFWSYYVFRGKVRHGEGYH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatcttccggttatctggtttgccattattgtattcgccacgctgatgtat
atcgtcatggatggtttcgatctgggggtcggtatcctgtttccgtttattcgtgataaa
cacgatcgcgatgtcatggtgaactcggtcgcgccggtatgggatggcaacgaaacctgg
ctggtcatggggggcgctggcctgttcggcgcattcccgttggcctatgctgttatcgcg
gatgcgctgactatcccgctggtgataatgctgcttggcctgatttttcgcggtgtcgcc
tttgaattccgctttaaagccaccgagtcgcatcgcgccttttgggataagtcctttatc
gtggggtcaattctggcaacttttgcccagggggttgtagtaggcgctgtggtgagcggt
tttcaggtagaggggcgaacctttagtggttcacagcttgactggctgacgccgtttaac
ctgttctgcggtgtgggactggtcatcacctatgcattattgggcgccacctggctcatt
atgaaaagcgaagatccgctgcatagccggatgtgtgaactgtcgcgcccgctgttgatc
gccctgttgctggtaatgggaggcgtcagtatatggacgccgctgacccacagtgctatc
gccgagcgctggttcacgttgcctaatttatactacttcttgccggtaccagtactggta
ttgatctttagcgcatggctatggcgcagcgtgaaaaatcctcaatctcatgcgcgtccg
tttgtcctcacgctagggttaattttcctggggttcagcgggttaggcatcagtatctgg
ccaaacattatcccgccggatatttcgctgtatgccgcctctgcgccgccacaaagtcaa
agctttatgctggttggagcgctggtaatcattccgatcattttggcttataccttctgg
agctattacgttttccgtggaaaagttcggcatggagagggatatcactga

DBGET integrated database retrieval system