KEGG   Salmonella bongori NCTC 12419: SBG_0324Help
Entry
SBG_0324          CDS       T01579                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SBG_0324 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SBG_0324 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SBG_0324 (lacZ)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SBG_0324 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(376302..379379)
Genome map
AA seq 1025 aa AA seqDB search
MNQERDFLSSVLSRRDWENPGVTQLNRLASHPPFYSWRHADDARHDEPSSRRRSLNGQWK
FNWFASPEAVPEAWRLHDLQHADTITVPSNWQMYGYDAPIYSNITYPFPVNPPFVPAENP
TGCYSLTFNINNDELQDGKTRIIFDGINSAFYLWCNGRWVGYGQDSRLPSEFDLSDFLRE
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVYLLHKPSTYISDLHINTHFNDDFSRAV
VDAEIRSTGDLHDNLHVTVQLWDGETLIGKKTAPLGSDIIDERGAYHDRTTLRLKVEHPR
LWSAETPNLYRAVALLHTADNTLIEAEACDIGFRQVRIENGLLLLNGKPLLIRGVNRHEH
HPQQGQVMDYDTMLKDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MTPMNRLSDDPVWLPAMSQRVTRMVQRDRNHPSIIIWSLGNESGHGANHDALYRWLKSAD
VSRPVQYEGGGADTAATDIVCPMYARVDQDQPFPAVPKWSIKKWLSLPGEQRPLILCEYA
HAMGNSLGGFTKYWQAFRQYPRLQGGFVWDWVDQSLIKYDADGKPWSAYGGDFGDAPNDR
QFCMNGLVFADRTPHPALFEAKHAQQFFQFRLLPGSGRQIEVTSEYLFRHSDNERLHWSL
AQNGKPVTGGEVTLDIPPQGHQRITLPEFPQPETAGQLWLTVRVEQPQATAWSQAGHICA
WQQWKLAEKLNIQLPPTANTTPQLSVDDHAFTVEVNGKRWQFCRKLGFLIQYRINDEEQL
LTPLVDQFTRAPLDNDIGVSEATRIDPTAWVERWKAAGHYQAEASLLQCDADALASAVLI
TTVHVWQYEGNPLFISRKTYRIDGNGEMQITVDVDVNYGTPPPARIGLNCQLVAVADRVN
WLGLGPHESYPDRLSAACFDRWELPLEEMYTPYVFPSENGLRCATRELNYGPHRWRGDFQ
FNISRFSQQQLMETRHRHLLQPEAGTWLNIDGFHMGVGGDDSWSPSVSAEYVLSAGRYHY
QLSWY
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggagcgtgattttctctcttcagtattatccaggcgtgactgggagaatcct
ggcgtaacacaactcaaccggctggcctcacacccacctttttatagctggcgtcatgct
gatgacgcacgccacgacgaaccatcatcccgacgtcgtagcctgaacggccaatggaaa
tttaattggttcgcctcgcccgaagccgttccggaggcgtggcgtctgcatgacctgcaa
cacgcggataccattaccgtaccatcgaactggcagatgtacggctatgacgcgccgatt
tactctaacattacctatccgtttccggttaatccaccgttcgttccggcagaaaacccc
acgggatgttattcgctcacatttaatattaataacgatgaattacaggatgggaaaacg
cggatcatttttgatggtatcaactccgcattctatttgtggtgcaacggacgctgggta
ggctacgggcaggacagccgtctgccatcggaattcgatctcagtgattttttacgtgag
ggggaaaaccgcctcgcggtgatggtgctgcgctggagtgatggcagctacctggaagac
caggatatgtggcgaatgagcgggattttccgtgatgtttacctgctgcataaaccctcg
acgtacatcagcgatctgcacattaacactcacttcaacgacgatttcagccgggcggtg
gtggatgcggaaatcagatcgacaggcgatctgcacgataatttacacgtgacggtacag
ctatgggatggcgaaaccttaatcggcaagaaaaccgcgccattaggcagcgatatcatt
gatgaacgcggcgcgtaccatgaccgtacaacgctgcgcctgaaggttgaacatcccagg
ctgtggagcgccgaaacgccgaatctgtaccgcgccgttgcgctgctacacaccgccgac
aatacgctgattgaagccgaagcctgcgacattggttttcgccaggtacgtatcgaaaac
ggcctgttgttgctgaacggtaaaccgcttttgattcgcggcgtgaatcgccatgagcat
cacccacagcagggtcaggtcatggattacgacaccatgctgaaagatatcctgttaatg
aagcagaataacttcaacgccgtgcgctgttcgcactacccgaaccatccgctgtggtac
acgctgtgcgatcgctacggtctgtatgtggtggatgaggccaatatcgaaacccacggc
atgacacccatgaatcgcctgagcgacgatcccgtctggctaccggccatgagccagcgc
gtaacgcggatggtgcagcgcgatcgcaaccatccgagcattattatctggtcgctgggc
aatgaatccggccatggcgcaaatcatgatgcgctctatcgctggctcaaatccgcagac
gtttcccgtccagtgcaatatgaaggtggcggtgcggataccgccgcaaccgatattgtc
tgcccgatgtacgcacgtgtcgatcaggatcaacccttccccgccgtaccgaagtggtca
atcaagaaatggttgtcattacccggcgaacagcgcccgctgatcctctgtgaatacgct
catgcgatggggaatagcctcggcggtttcaccaaatactggcaggcctttcgtcaatac
ccgcggctacaaggtggttttgtctgggactgggtcgaccaatcgctgatcaaatatgat
gccgatggcaaaccatggtcggcctacggcggcgactttggcgatgcgccgaacgatcgc
cagttctgcatgaacgggctggtttttgccgatcgtaccccacatcccgcactgtttgaa
gccaaacacgcccaacagtttttccagttccggttactgccaggctccgggcgccagatt
gaagtgaccagcgaatatctgttccgtcacagcgacaacgaacgtctgcactggtcgctg
gcacagaacggcaaaccggtcactggtggcgaagtaacgctggatattcctccacaaggg
catcagcgcatcacgctccccgaatttccgcagccggagaccgcgggccagctttggcta
accgtgcgcgtcgaacagccgcaggcaacagcgtggtcgcaagccggacacatctgcgcc
tggcaacaatggaaactggcggaaaaacttaatatccagcttcctcccactgcaaacacc
acaccacaattaagcgttgatgatcatgcctttacggtggaagtcaacggtaagcgctgg
cagttctgccgcaagctgggttttctgattcagtacagaataaatgatgaagagcagttg
ctgacgccgctcgttgaccagtttacccgcgcgccgctggataacgatatcggtgtcagc
gaggccacgcgcatcgatcccaccgcctgggttgagcgctggaaggccgcaggtcattat
caggcagaagccagcttactgcaatgtgatgccgacgcgctggcaagcgcggtactgatt
accaccgtccatgtgtggcagtatgagggtaacccgctgtttatcagccggaaaacgtac
cgcatcgatggtaatggcgagatgcaaattacggtcgatgttgacgttaactacggcaca
ccgccgcctgcgcgtatcggtctgaactgccagttggtagcggtggcggatcgggtgaac
tggttgggacttggcccccatgaaagctacccggacagactcagcgctgcctgtttcgat
cgctgggagctaccgcttgaggaaatgtatacgccgtacgtcttcccgagcgaaaatggc
ctgcgctgcgccactcgcgagctgaactatggcccgcaccgctggcggggggattttcag
ttcaacatcagtcgctttagccagcagcagttgatggaaacccgccatcgtcacctgcta
caaccggaagcaggaacgtggctcaatattgacggtttccacatgggtgtggggggcgat
gactcatggagcccgtcggtatcggcggaatatgtgctcagcgccggacgctaccattac
cagttaagctggtactga

DBGET integrated database retrieval system