KEGG   Salmonella bongori NCTC 12419: SBG_0328Help
Entry
SBG_0328          CDS       T01579                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(383577..384551)
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYQAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDAWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPIGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADVIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgtcgcctgcgcaaatctgccgcgctgcgcgctatg
tttgaagagacaacactcagtctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgactaccaggccatcgacgccatgcccggtgtgatgcgtattccggaaaaacag
ctggcgcgggaaattgaacgtatcgccaacgctggtattcgttctgttatgaccttcggc
atttctcaccataccgatgacactggcagcgatgcctggaaagaagatggcctggtggcg
agaatgtcccgcatctgtaagcaaaccgtgccggagatgattgtcatgtccgatacctgt
ttctgcgagtacacctcgcacggtcactgcggcgtcctgtgcgaacatggcgttgataac
gatgcgacgctggccaacctcggcaagcaggccgttgttgcagcagcggctggcgcagat
tttatcgcgccttctgcggcgatggatggacaagtccaggccattcgtcaggcgctggac
gccgctggttttaccgatacggccatcatgtcctactccactaaatttgcgtcttctttt
tatggtcctttccgtgaggcagcagggacggcgttgaaaggcgatcgcaaaacctatcag
atgaacccgatgaaccgtcgtgaagcgattcgcgaatctctactcgacgaagcgcaaggc
gcagactgtctgatggttaaacccgcaggcgcctatctggatgtgctgcgtgaaatccgc
gagcgcacggagttgccgattggcgcttatcaggtgagcggcgaatacgccatgattaaa
tttgccgctatggctggcgccattgacgaagaaaaagtcgtgctggaaagtctgggctca
attaaacgcgccggtgccgatgtgatttttagttacttcgcgctggatctggctgagaag
aaaattctgcgttaa

DBGET integrated database retrieval system