KEGG   Salmonella bongori NCTC 12419: SBG_0627Help
Entry
SBG_0627          CDS       T01579                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00020  Citrate cycle (TCA cycle)
sbg00190  Oxidative phosphorylation
sbg00650  Butanoate metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
Module
sbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBG_0627 (sdhD)
   00650 Butanoate metabolism
    SBG_0627 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SBG_0627 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: CCC29719
UniProt: A0A0K0H823
Position
707447..707794
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYILYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLGLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcattctggtccgt
gctaccgctatcgttctgacgttatacattctctacatggtcggtttttttgcgaccagc
ggcgagctgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagttttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccactggcagtccgtcttggactgcaactcgctattgtcgttgcg
ctggtggtttacgtcatttatggatttgttgtggtgtggggggtgtaa

DBGET integrated database retrieval system