KEGG   Salmonella bongori NCTC 12419: SBG_0631Help
Entry
SBG_0631          CDS       T01579                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component (E2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBG_0631 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBG_0631 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SBG_0631 (sucB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SBG_0631 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713573..714793
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASADGVLDAV
LEEEGATVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLGEHNLDASAIKGTGVGGRITREDVEKHLANAPAKTETKAPAAESAPQAPMSARGEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYV
KAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEKKI
KELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVD
GKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcaaccgtt
gcgacatggcataaaaaaccgggcgatagtgtccagcgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcgttctggatgcggtt
ctggaagaggagggggctaccgtgacctctcgccagatcctcggtcgcctgcgtgaaggc
aatagcgccggtaaagagaccagtgcgaaatctgaagagaaagcctctaccccggcccag
cgccagcaggcctcgctggaagaacaaaacaatgatgcgctcagcccggcgatccgtcgc
ctgctgggtgagcataaccttgacgccagcgccatcaaagggaccggcgttggcggtcgc
atcactcgtgaagatgtagaaaaacatctggcgaacgccccggcaaaaacggaaaccaaa
gccccggccgctgagtctgcgccgcaggcaccaatgagcgcgcgcggtgaaaaacgcgta
ccgatgacgcgtctgcgtaagcgcgtggcggaacgtctgttggaagcaaaaaattccacc
gctatgctgacgactttcaacgaagtcaacatgaagccgattatggatctgcgtaagcag
tacggcgaagtgttcgagaaacgtcatggcatccgcctgggctttatgtccttctacgtg
aaagcggtagtggaggcgctgaaacgctatccggaagtgaacgcttccatcgacggcgac
gatgtggtgtaccacaactacttcgacgtgagcatggcggtttctacgccgcgcggcctg
gtcacgccagtattacgtgacgtggatttactgggcatggctgacatcgagaagaaaatt
aaagagctggcggtgaaaggccgtgacggcaaactgactgtagaggacctgactggcggt
aacttcaccattaccaacggtggcgtattcggttcactgatgtctaccccgatcattaac
ccgccacaaagcgcgattctggggatgcacgccattaaagatcgtccgatggcggtggat
ggaaaggtggaaatcctgccgatgatgtacctggcgctctcttacgatcaccgtctgatc
gatggtcgcgagtccgtgggtttcctggtcaccattaaagaattgttggaagatccgacc
cgtctgttactggacgtgtag

DBGET integrated database retrieval system