KEGG   Salmonella bongori NCTC 12419: SBG_0655Help
Entry
SBG_0655          CDS       T01579                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg00260  Glycine, serine and threonine metabolism
sbg00680  Methane metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
sbg01230  Biosynthesis of amino acids
Module
sbg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbg_M00002  Glycolysis, core module involving three-carbon compounds
sbg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_0655 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SBG_0655 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBG_0655 (gpmA)
Enzymes [BR:sbg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SBG_0655 (gpmA)
Membrane trafficking [BR:sbg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SBG_0655 (gpmA)
Exosome [BR:sbg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SBG_0655 (gpmA)
  Exosomal proteins of melanoma cells
   SBG_0655 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCC29746
UniProt: A0A0K0H8S5
Position
complement(739026..739778)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDKMSEDEILELNIPTGVPLVYEFDENFTPVKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaagctggttctggtacgtcacggtgaaagtcagtggaacaaagaaaac
cgtttcactggctggtatgatgtggacctgtctgaaaaaggggtaagcgaagcaaaagcg
gcaggtaagcttctcaaagaagaaggtttcagttttgattttgcctacacctccgtcctg
aaacgcgctatccatacgctgtggaacgtactggatgaattggatcaggcctggctgccg
gtggaaaaatcatggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggcgatgagcaggttaaacagtggcgccgcggttttgcc
gttacgccgccggaactgaccaaagatgacgagcgttatccgggtcacgatccgcgttat
gccaaactgagcgagaaagagctaccgctgaccgaaagcctggcactgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtcatc
atcgctgctcacggtaactccctgcgtgcgctggtgaaatacctggataagatgagtgaa
gatgagatccttgagttgaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aactttacgccagtaaaacgctactatttgggcaacgctgacgagatcgcagcgaaagcg
gctgccgtggcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system