KEGG   Salmonella bongori NCTC 12419: SBG_0671Help
Entry
SBG_0671          CDS       T01579                                 

Definition
pectin esterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sbg00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758032..759315)
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQIAPGTASRPILSASEAKNFVATRYFA
SLTPNTAPWSPSPISLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMSIDGEMSVADWRHAVNPGGKYMPGKPAWY
MFDNCQSKRAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QIDKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTTF
QVVNSRTQKEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVATPWADAVISKRQFAGNTGTVDDKGEVQRNLNDTNYNRMWEYNNRGVGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccgcccgatcaaattccttccgatcaaatcgcgcctggcaccgcc
tcgcgcccgattttgtcggccagtgaagcgaaaaacttcgtggcgacgcgttatttcgcc
tccctgacgccgaataccgcgccgtggtcgccgtcgccgatttccctgcccgcgcagcct
gactttgtggttggcccggcaggcacacctggcgttacgcacacgtcgattcaggccgct
gtcgatgcggcgatggttaaacgtacaaacaaacgtcagtacatcgctattatgccgggc
gactatcaagggaccgtttatgttcccgccgcgccaggcagcctgactctgtacggcacc
ggtgaaaaaccgatcgatgtgaaaatcggcatgtcgattgatggtgaaatgagtgttgcc
gactggcgtcacgcggtgaatcctggcggaaaatacatgccgggtaaaccggcgtggtat
atgtttgataattgtcaaagcaaacgcgctgcgactatcggggtgatgtgttccgccgct
ttctggtcgcaaaataatggtcttcagttacagaatttgaccatcgaaaacaccctgggc
gacagcgttgatgccggtaatcatcctgcggtagcgctgcgtaccgatggcgataaagtc
cagattgacaaggtgaatatccttggccgccagaacaccttctttgtaactaatagcggc
gtacagaaccgtctacaaaccgatcgtcagccgcggacgctggtcacaaacagctatatt
gaaggggatgtggatatggtttccggtcgtggcgccgtggtgttcgataacaccaccttc
caggtcgtcaactcccgcacccagaaggaagcttacgttttcgccccggcgacgctgtcc
aatatttactatggtttcctcgcgatcaacagtcgctttaacgcatccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacacgaatggtcaggtggtgatccgc
gacagcgtgattaacgagggctttaatgtcgctactccctgggccgacgcggttatctca
aaacgtcagtttgccgggaatacaggaaccgtggatgacaaaggcgaggtacagcgtaac
cttaacgacacgaactacaaccgcatgtgggaatacaacaaccgcggcgtaggcagtaaa
gtggtggcggaacctaagcagtaa

DBGET integrated database retrieval system