KEGG   Salmonella bongori NCTC 12419: SBG_0770Help
Entry
SBG_0770          CDS       T01579                                 

Gene name
rimK
Definition
ribosomal protein S6 modification protein
Orthology
K05844  
ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
Enzymes [BR:sbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     SBG_0770 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864280..865182
Genome map
AA seq 300 aa AA seqDB search
MKIAILSRDGALYSCKRLREAAMQRGHLVEVLDPLSCYMNINPAASSIHYKGRRLPHFDA
VIPRIGSAITFYGTATLRQFELLGSYPLNESVAITRARDKLRSLQLLARQGIDLPITGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
AEAKGRDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATITPRERDIAIKAAQTL
GLDVAGVDILRAMRGPLVMEVNASPGLEGIEKTTGVDIAGRMIQWIERHATPEFCLKTGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgccatattgtccagggatggagcgctctattcttgtaaacgcctgcgcgaa
gcggcaatgcaacgcggccatctggtagaagtacttgatccgctttcctgctacatgaat
attaatccggcagcctcgtcaatccattacaagggacgtcgtctcccccattttgacgcc
gttattccccgtattggctccgctattaccttttatggtacggctacgctgcgtcagttt
gaactgctgggcagctacccgctgaatgagtccgtcgccattacccgtgcgcgcgataag
ctccgctcgctccaacttctggcgcgccaggggatcgatcttcccattactggcatcgcc
cattcgccggacgataccagcgatcttattgatatggttggcggagcgccgctggtcgta
aaattggtcgagggcacacaaggcatcggcgtagtattggcggagacgcgtcaggccgct
gaaagcgtcattgatgcgttccggggacttaatgcccatattctggtacaggaatacatt
gctgaagccaaagggcgggatattcgttgtctggtcgtcggcaatgaggttgtggcagca
attgaacggtgcgcgaaagcaggcgattttcgttcaaatcttcatcgcggcggcgtggcc
agtatcgcgacgatcacgccccgtgaacgggatattgccattaaagccgcacagacgctc
gggctggacgtggcgggcgttgatattttacgcgcaatgcgtgggccgttggttatggaa
gtgaatgcctcgccgggactggagggcatcgaaaaaaccaccggtgtggatatcgcgggg
cggatgatccagtggatcgagcgccatgccacacctgaattttgtcttaaaaccggcgga
taa

DBGET integrated database retrieval system