KEGG   Salmonella bongori NCTC 12419: SBG_0770Help
Entry
SBG_0770          CDS       T01579                                 

Gene name
rimK
Definition
ribosomal protein S6 modification protein
Orthology
K05844  
ribosomal protein S6 modification protein
Organism
sbg  Salmonella bongori NCTC 12419
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864280..865182
Genome map
AA seq 300 aa AA seqDB search
MKIAILSRDGALYSCKRLREAAMQRGHLVEVLDPLSCYMNINPAASSIHYKGRRLPHFDA
VIPRIGSAITFYGTATLRQFELLGSYPLNESVAITRARDKLRSLQLLARQGIDLPITGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
AEAKGRDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATITPRERDIAIKAAQTL
GLDVAGVDILRAMRGPLVMEVNASPGLEGIEKTTGVDIAGRMIQWIERHATPEFCLKTGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgccatattgtccagggatggagcgctctattcttgtaaacgcctgcgcgaa
gcggcaatgcaacgcggccatctggtagaagtacttgatccgctttcctgctacatgaat
attaatccggcagcctcgtcaatccattacaagggacgtcgtctcccccattttgacgcc
gttattccccgtattggctccgctattaccttttatggtacggctacgctgcgtcagttt
gaactgctgggcagctacccgctgaatgagtccgtcgccattacccgtgcgcgcgataag
ctccgctcgctccaacttctggcgcgccaggggatcgatcttcccattactggcatcgcc
cattcgccggacgataccagcgatcttattgatatggttggcggagcgccgctggtcgta
aaattggtcgagggcacacaaggcatcggcgtagtattggcggagacgcgtcaggccgct
gaaagcgtcattgatgcgttccggggacttaatgcccatattctggtacaggaatacatt
gctgaagccaaagggcgggatattcgttgtctggtcgtcggcaatgaggttgtggcagca
attgaacggtgcgcgaaagcaggcgattttcgttcaaatcttcatcgcggcggcgtggcc
agtatcgcgacgatcacgccccgtgaacgggatattgccattaaagccgcacagacgctc
gggctggacgtggcgggcgttgatattttacgcgcaatgcgtgggccgttggttatggaa
gtgaatgcctcgccgggactggagggcatcgaaaaaaccaccggtgtggatatcgcgggg
cggatgatccagtggatcgagcgccatgccacacctgaattttgtcttaaaaccggcgga
taa

DBGET integrated database retrieval system