KEGG   Salmonella bongori NCTC 12419: SBG_1047Help
Entry
SBG_1047          CDS       T01579                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBG_1047
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SBG_1047
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SBG_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155715..1156740
Genome map
AA seq 341 aa AA seqDB search
MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFFALLGQEEGGRLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERAYHADPTKVLAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
CDPRPEAVIRDKDMSVFRTLISENKLDAIMPAHVIYSAVDSRPASGSPHWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
THLYHKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttgaatgtcgaaggatgtgagctggatgcggaagagcgggagata
ctggcgcatccgctggttggcgggctcattctgttcacgcgcaattaccatgatccggaa
cagctacgtgaattagttcgacagattcgggcggcgtcgcgtaaccatctggtggtggca
gtcgatcaggaaggcgggcgtgtacagcgttttcgcgaaggatttacccgcctgcccgcg
gcgcaatctttctttgcgttactcggacaggaagaaggaggacggctggcgcaggaagca
ggctggctgatggccagcgaaatgattgcgatggatattgatattagttttgcgccggta
ctggatgtcggccatatcagcgcggccatcggcgagcgtgcttatcatgccgatcctaca
aaagtactggcaatggcgacgcgctttattgacggtatgcatgacgccggaatgaaaaca
accggtaaacattttcccggtcacggcgcagtcacggcggattcccacaaagagacgcca
tgcgatccgcgccctgaagctgtcattcgtgacaaagatatgtcggtatttcgcacgctg
attagcgagaataagctggatgcgattatgcctgcgcacgtcatctacagcgcggttgat
tcgcgtccggcaagcgggtcgccacactggttgaaaaccgtgctacgtcaggaactgggt
tttgatggcgtgattttctctgatgatctctcgatggaaggggcggcgattatgggtagc
tatgctgaacgcgctcaggcatcgctggacgcgggttgcgatatgattctggtctgtaat
aatcgtaaaggcgcagtcagcgtgttggataatctgtcgccgatcaaagcagagcgtgtt
acacatttgtatcataaaggttcattttcgcgccgggagctcatggactcagcacgctgg
aaaaccgccagtgctcagctcaaccagttgcatgaacgctggcaggaagaaaaagcaggt
cattaa

DBGET integrated database retrieval system