KEGG   Salmonella bongori NCTC 12419: SBG_1134Help
Entry
SBG_1134          CDS       T01579                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1134
Enzymes [BR:sbg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SBG_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CCC30224
UniProt: A0A0K0H9G0
Position
complement(1245471..1246355)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQFTPVLSRRQLDDLELVVIDHPQVKAAFALQGAHLLSWKPVGEEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFE
LQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVQVSGL
GDRFIDKVNDAKEGILADGVQAFPDRTDRVYLNPEACSMIHDKTLSRTIEVVHHHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYATAPQKATEEKPSRLAQTIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctaccggttatcgaacagtttactcctgtcttatcccgc
cgccagcttgacgatctggagctggttgttatcgaccatccacaggttaaagccgctttt
gcattacagggtgcgcatcttctttcctggaaacccgttggcgaggaagaggtattgtgg
ctcagtaataatacgcctttcaaaaccggcgtggcgctacgtggcggcgtaccgatctgc
tggccctggtttggacctgcggctcaacaaggtctgccgtcacacggctttgcgcgtaat
ctaccgtgggcgctaaaagcgcataatgaagatgataatggcgtaatgctgacatttgag
ctgcaaagcagtgaggccacccggaaatactggccgcacgatttcacgctgctggcacgt
tttaaagtaggcaaaacctgtgaaattgaactggaagcacatggcgagtttgcaaccaca
tccgctctccacagctattttaacgttggcgatatcgccaacgttcaggtcagcggactc
ggcgatcggtttattgataaagttaacgatgccaaagaaggtatcctggccgacggcgtt
caggccttcccggaccgtaccgatcgcgtttatctcaatcctgaagcatgtagcatgatc
cacgataagacgttaagccgtacgattgaggttgttcaccaccatcatcttaacgttgta
ggctggaaccctggcccggcgttgtccgtcagcatgggcgacatgccagatgacggctat
aaaacatttgtgtgcgttgaaacggcttacgccactgcgccgcaaaaagccacagaagaa
aagccctcccgtctggcacagactatccgcgtcgcaaaacgttaa

DBGET integrated database retrieval system