KEGG   Salmonella bongori NCTC 12419: SBG_1146Help
Entry
SBG_1146          CDS       T01579                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sbg00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258500..1259156)
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVPEGDSTIDVANYLIDWCQSRQIPVLASQDWHPARHGS
FASQHQAEPYSQGELDGLPQTLWPDHCVQHTEGAALHPLLNHHAIDATIYKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHRVTELIVMGLATDYCVKFTVLDALQSGYAVNVITDGCRG
VNIHPQDSAHAFMEMAAAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagggctttattgctggtcgatttgcagaatgatttttgtgctggcggcgcg
ctggccgtaccggaaggcgatagcactattgatgtcgccaactatcttattgactggtgc
cagtcccgccagattccggtgctcgccagccaggactggcatccagccagacacggcagc
ttcgccagccagcatcaggcggagccctatagccagggagaactggatggtttgccgcaa
acactttggcccgatcactgtgttcaacacactgaaggcgcagcgttacatcctctgctt
aatcaccatgcgatcgacgctaccatttataaaggcgaaaacccgctgattgacagctac
agtgcattttttgacaacgaacatcggcagaaaacgacccttgatacctggcttcgcgag
catcgcgttacggagctgattgtgatgggactggctaccgattactgcgtaaaatttacg
gtgctggatgcattacagtcaggctacgccgttaacgttatcaccgatggctgccgtggc
gtgaatattcacccgcaggatagcgcacacgcgtttatggagatggcggcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaggctgtcgccaggtag

DBGET integrated database retrieval system