KEGG   Salmonella bongori NCTC 12419: SBG_1180Help
Entry
SBG_1180          CDS       T01579                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBG_1180 (pfkB)
   01230 Biosynthesis of amino acids
    SBG_1180 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1180 (pfkB)
   00030 Pentose phosphate pathway
    SBG_1180 (pfkB)
   00051 Fructose and mannose metabolism
    SBG_1180 (pfkB)
   00052 Galactose metabolism
    SBG_1180 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SBG_1180 (pfkB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SBG_1180 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1292381..1293310)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGAATAIFP
AGGATGEHLVALLADEHVPVSTVNAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEHVLEIESGAILVISGSLPPGVKVDKLTQLISAAQRQGIRCIIDSSGEALTAALALGG
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGVDGENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAEDASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttaacgcttgcgccctcactcgatagcgcaacaatcacaccg
caaatttatcccgaaggtaaactgcggtgttccgcgccggtattcgaacccggcggcggc
ggtattaatgtcgctcgcgccattgcgcatcttggcggcgccgcaaccgcaatttttcca
gcgggcggcgcaaccggtgagcatctggttgccttactggccgacgaacatgtcccggtt
tctaccgttaatgcaaaagactggacccgccagaacctgcacgtccatgttgagtccagc
ggcgagcagtatcgttttgtcatgcctggcgccacgcttgacgatgatgaatttcgccaa
cttgaagaacacgtgctggaaattgaatcaggggcaatcctggttatcagcggtagcctt
ccgcctggggttaaggtcgacaagctcacacaattaatttccgctgcgcagagacaaggc
attcgctgcattattgacagctccggcgaagcactcaccgcagccctggcgcttggcggc
atcgaactggtgaaacctaacctgaaagaattgagtgcgttagtcaaccgcgatctgaca
caacctgatgatgtgcgtaaagcagctcaggaattagtacaaagcggcaaagcgcgccgg
gtggtcgtctctttggggcctcagggggcgctgggcgtagatggcgaaaactgcatccag
gtcgttcctcccccggtgaaaagccaaagcaccgtcggcgctggcgacagtatggtaggc
gccatgacattaaaattggcggaagacgcgtcgctggaggagatggtgcgctttggcgta
gcagcgggtagcgccgccacgctcaatcagggtacgcgtctgtgctctcacgatgatacc
caaaaaatatacgcttatctttccgcataa

DBGET integrated database retrieval system